SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303409 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303409
Domain Number 1 Region: 481-783
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.73e-69
Family Ankyrin repeat 0.00000723
Further Details:      
 
Domain Number 2 Region: 21-318
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.75e-61
Family Ankyrin repeat 0.0000291
Further Details:      
 
Domain Number 3 Region: 961-1166
Classification Level Classification E-value
Superfamily ADP-ribosylation 9.3e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0022
Further Details:      
 
Domain Number 4 Region: 332-471
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.37e-23
Family Ankyrin repeat 0.00042
Further Details:      
 
Domain Number 5 Region: 892-953
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000102
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303409   Gene: FBgn0027508   Transcript: FBtr0330383
Sequence length 1520
Comment pep:known chromosome:BDGP5:3R:21478807:21487003:-1 gene:FBgn0027508 transcript:FBtr0330383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSSRSRAILSVNLDAVMANDPLRELFEACKTGEIAKVKKLITPQTVNARDTAGRKSTP
LHFAAGYGRREVVEFLLNSGASIQACDEGGLHPLHNCCSFGHAEVVRLLLKAGASPNTTD
NWNYTPLHEAASKGKVDVCLALLQHGANHTIRNSEQKTPLELADEATRPVLTGEYRKDEL
LEAARSGAEDRLLALLTPLNVNCHASDGRRSTPLHLAAGYNRIGIVEILLANGADVHAKD
KGGLVPLHNACSYGHFDVTKLLIQAGANVNANDLWAFTPLHEAASKSRVEVCSLLLSRGA
DPTLLNCHSKSAIDAAPTRELRERIAFEYKGHCLLDACRKCDVSRAKKLVCAEIVNFVHP
YTGDTPLHLAVVSPDGKRKQLMELLTRKGSLLNEKNKAFLTPLHLAAELLHYDAMEVLLK
QGAKVNALDSLGQTPLHRCARDEQAVRLLLSYAADTNIVSLEGLTAAQLASDSVLKLLKN
PPDSETHLLEAAKAGDLDTVRRIVLNNPISVNCRDLDGRHSTPLHFAAGFNRVPVVQFLL
EHGAEVYAADKGGLVPLHNACSYGHYEVTELLVKHGANVNVSDLWKFTPLHEAAAKGKYD
ICKLLLKHGADPMKKNRDGATPADLVKESDHDVAELLRGPSALLDAAKKGNLARVQRLVT
PESINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLHNASSYGHLD
IAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELAT
ADDVKCLLQDAMATSLSQQALSASTQSLTSSSPAPDATAAAAPGTSSSSSSAILSPTTET
VLLPTGASMILSVPVPLPLSSSTRISPAQGAEANGAEGSSSDDLLPDADTITNVSGFLSS
QQLHHLIELFEREQITLDILAEMGHDDLKQVGVSAYGFRHKILKGIAQLRSTTGIGNNVN
LCTLLVDLLPDDKEFVAVEEEMQATIREHRDNGQAGGYFTRYNIIRVQKVQNRKLWERYA
HRRQEIAEENFLQSNERMLFHGSPFINAIVQRGFDERHAYIGGMFGAGIYFAEHSSKSNQ
YVYGIGGGIGCPSHKDKSCYVCPRQLLLCRVALGKSFLQYSAMKMAHAPPGHHSVVGRPS
AGGLHFAEYVVYRGEQSYPEYLITYQIVKPDDSSSGTEDTRXWMPSVGSTPTTTSPALHQ
PQTQQQPQQQQQQQPQPQQQQKAPLPLPPPQQQTSAPVAKRRPKHAKPSLQLQYQPYQPQ
HHPVVATAAAVTTTQPSPAGVFAHSNNNNNTSSGNVNNNNNDMSPVSNSNSYSSVDTNQT
LLNSLANQQRNHRQPQNHHHQQQQQANRSQKYSQFMIITPAVSIDRDFEYESHLDFEDFA
NAAHNNGNLFRLGLRRSDSSSDDSGHSSDSSSFRSNYNPYLHHSRQHLLSKGGNGGGGGA
SRHFYAFTSSWRWCSLLCAAMRCFGAGGAGHGNAPYSSSLQHHRLRRCSSYNAENAYEHF
AAPFKARKTRDHMNNITYEL
Download sequence
Identical sequences A0A0B4KI19
FBpp0303409 NP_001262963.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]