SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303414 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303414
Domain Number 1 Region: 77-145
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.95e-18
Family SAM (sterile alpha motif) domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303414   Gene: FBgn0263117   Transcript: FBtr0330388
Sequence length 453
Comment pep:known chromosome:BDGP5:3R:18135203:18149816:-1 gene:FBgn0263117 transcript:FBtr0330388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKATSSSSCSSAASSCNQPEPLATGVGSSGVSGASGASGASGASTSTKPQRLNKVSFAPL
DLPFPSGATXYANANASTSMPHHNIVCEWLRTIGLAHYGESFLENGYDELEICKQIGEID
LDAIGVDNPSHRGKLLKSVRMLREKGAAIVYVLINDPKALSSSNEILASDCDTPVTMKEL
EAVMKRHLEADGIRLTAHPYSTPEGKRGYLEGLAAHYSKQINMPYDDVLDAIEQVRLSKW
KERHVRISTGHTLSRRMAGPSCSGTGLVSSSVMPTSHSQPLYVPGKYLPSSCLSNREENE
IYSYTQNDLANRMARNAIDSKSALNLNGMQHSYPGARTNFFYNFSATEGRNKHKQRRTVF
HRFLQGLRQSGDELNATEGMQLKTNERLRNCSTMKRPEPHQDFEKTIQRLKTQKAAQKKP
ASAPMEMAIHDRNKEVAHTHVNEMPLNNYTKHP
Download sequence
Identical sequences A0A0B4KGJ9
NP_001262830.1.81976 FBpp0303414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]