SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303433 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0303433
Domain Number - Region: 19-49
Classification Level Classification E-value
Superfamily TAZ domain 0.0157
Family TAZ domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303433   Gene: FBgn0023130   Transcript: FBtr0330407
Sequence length 409
Comment pep:known chromosome:BDGP5:X:1587648:1589922:-1 gene:FBgn0023130 transcript:FBtr0330407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQKHSEPFYISPRLFDNRRLKRRRCRWMERLLEHQRICMARMRDQVALASKTDRQLSHL
QRRHVASTLQPDVTIDLLSDDDETPSAGQPAAAGHNRLLIPAPGHRAHRTGRRQAPRRAA
THSYPVTDSILITSDDEHNEQEPSSTARVRSQLSMRSPPPLAPLTQSETIEEVTVSLVPR
TSTTANCLTRVSGHPKPCRASTAASNGFATAEGGEGGNETGCFLEVDVGGGITATLPDET
TVHTVIANRIYELSLSKLREGLAFSGVPEYTNDLMPEQLQKLSPALRAKVAPLVAPSPPT
PISLKLSSDLSISLISDEDDCESTGPHVNGGVGTEPVHPVVVAAAEAHAAAKLLKQQQPQ
LSVVQHLQYVGGGLAAPVALALPVMAANPTSSASVVALPLQLPRRRKLG
Download sequence
Identical sequences M9PDH8 O46341
FBpp0070269 FBpp0070269 7227.FBpp0070269 NP_001259141.1.81976 NP_001259142.1.81976 NP_477309.1.81976 FBpp0070269 FBpp0303433 FBpp0305327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]