SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303463 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303463
Domain Number 1 Region: 19-99
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000872
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303463   Gene: FBgn0008654   Transcript: FBtr0330613
Sequence length 1396
Comment pep:known chromosome:BDGP5:2R:8884006:8895307:1 gene:FBgn0008654 transcript:FBtr0330613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLQNTHNTMESNAAMDAASPASRDVRQFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCI
LKHLLRAVYCPECKASGGKEINELNLKSDDTLRSLIYKLVPGLYQRECKELADFKEQHDL
VDEQTTDEPEFFTTTELISLSLEYHPAMLHQCGPGEVPPTIYLQCAAGLPVELLKRFLCS
KYNIETDNGLVEVEVTYKDEVLPTNFTLMDVAYCYNWSRESPMAFCYRILLYDNEQTKND
ENNLSRINQDIEPEHSVRRSKSAKSVTFAEDLESEIDSGSPRSKVRCKTPPKVSPSSKNK
RLTSSKREAEPESPVSNFKSLRSNDMRYSDYAVSKVKSEPEQEQFLLPREREQQPLEANT
NIVVSIPPSQLRKSYVDAEDFELKTANRKGVGHLPKLKIELNSMKSKLSMPLSAGPRLED
TSCSLSCSAQQLDLETYAKNIGLKPIEQPLQQSASNPDSKYSPNASPMSSCSSSTNGSSS
SLGTADASTSTSTSSSHRKRKKKHSKEPKDANGKRKKLHAEISSQTDGKMKVKITAKPNH
KLDFKRSHSLASGELDLQKLKLDSTSTSEALNRTLGEEARSINSLVVGGAPTPPPTPTAE
PEQQQQQQQQQQQPQQQQQQQQQQQQQQQFVVLPKIKDLTLPTSPPLPPSLFKAYTPSTT
PTAPHTVAGGKPKQQQQQMPQQPQAVLQQSLAKTNPAKPPLSSNNNRKPNSGHFAVPQAP
THRNMYHMQRYQSTPSSIASAANKMPKRSMSLDESHPAKQARLSQAQAMASSYAAKLHMQ
TSNQAKSQAAAFLPNPQMRSYGLPDLGSKPTLPMLCPASSSSQVTITPRPRATPSIYSFS
EPNIHVPALEIVRLPVNKQSAGGKGLTMPPLSPPATSSARLMGPPAALPKHAGHGHGAAK
RSCQMPTMPMPLPLPLPMPMTTIPAIVKSPPLSVALSGQRNNKGNSSNSNAYRTSPPALI
NLRNTAAPQHSFPSKSSPKVEANSKKSPPAAGCQGKTNGTAALDKSKTSLREFRPAVQSA
VTATATTSVTTAAGAGAGAGTGTGTALAKDADILDLSANPGRSNNDAKLAPNSPPAGNNN
NNNNNNNNNNNNNNNNNNNSTSNSLEAALNKIKQNISANSNGGPSTTSGSNSNGTTNGDD
LQNLHMLSESATAREKISIKAASSGNGSGSTSSSSAKPKNANALVRPQNASVRSIPNPSA
LAFRNQPAAASTAASISKPLTVRAEEKPKVSTSNPGSLSPTNTSSSSSSSSSGSSGCSAA
TSPRAMTKKPTTIDQVAANLNIRAEAKAAALAEEAPPVLSSNAAKSPELAKTTTAVALRP
EPKETPITVSAASTLLTIPSAVSSVSAVPETMAKPPVQIANAPVASSAXSQAFLWLCGTQ
MYLVAPLENLRNTDSN
Download sequence
Identical sequences A0A0B4KEM5
NP_001260933.1.81976 FBpp0303463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]