SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303573 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303573
Domain Number 1 Region: 518-659,715-865
Classification Level Classification E-value
Superfamily L domain-like 3.74e-58
Family Ngr ectodomain-like 0.00000031
Further Details:      
 
Domain Number 2 Region: 72-278
Classification Level Classification E-value
Superfamily L domain-like 1.02e-42
Family Ngr ectodomain-like 0.0004
Further Details:      
 
Domain Number 3 Region: 293-500
Classification Level Classification E-value
Superfamily L domain-like 2.72e-41
Family Ngr ectodomain-like 0.00063
Further Details:      
 
Domain Number 4 Region: 1137-1325
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-39
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 5 Region: 1064-1110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000719
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 934-1068
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000127
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 7 Region: 904-946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family EGF-type module 0.007
Further Details:      
 
Domain Number 8 Region: 1352-1393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000396
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303573   Gene: FBgn0264089   Transcript: FBtr0330729
Sequence length 1480
Comment pep:known chromosome:BDGP5:2R:11757559:11809623:-1 gene:FBgn0264089 transcript:FBtr0330729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSRTTLMPPPFRLQLRLLILPILLLLRHDAVHAEPYSGGFGSSAVSSGGLGSVGIHI
PGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDF
QRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLD
NNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSW
LSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCR
CADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISR
IAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSL
SLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCE
SPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSDCPAMCHCEGTTVDCTGRGLKEI
PRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQEL
QLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCH
LAWFAEWLRKKSLNGGAARCGAPSKVRDVQIKDLPHSEFKCSSENSEGCLGDGYCPPSCT
CTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITI
LSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSL
THIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRV
RNDILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNAT
CTVLEEGRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEF
CDTKIQFCSPEFNPCANGAKCMDHFTHYSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCV
DGINDYQCRCPDDYTGKYCEGHNMISMMYPQTSPCQNHECKHGVCFQPNAQGSDYLCRCH
PGYTGKWCEYLTSISFVHNNSFVELEPLRTRPEANVTIVFSSAEQNGILMYDGQDAHLAV
ELFNGRIRVSYDVGNHPVSTMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEG
SNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGNAQRQQK
ITPGCALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQC
KCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTENDCRSRQPLKYAKCVGGCGN
QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY
Download sequence
Identical sequences NP_001097333.1.81976 NP_476728.1.81976 FBpp0086437 FBpp0111744 FBpp0303573 FBpp0303576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]