SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303575 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303575
Domain Number 1 Region: 76-256,335-495
Classification Level Classification E-value
Superfamily L domain-like 4.57e-58
Family Ngr ectodomain-like 0.0052
Further Details:      
 
Domain Number 2 Region: 542-683,739-889
Classification Level Classification E-value
Superfamily L domain-like 4.76e-58
Family Ngr ectodomain-like 0.00000031
Further Details:      
 
Domain Number 3 Region: 1161-1349
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-39
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 4 Region: 1088-1134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000743
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 928-970
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000172
Family EGF-type module 0.007
Further Details:      
 
Domain Number 6 Region: 958-1092
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000204
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 7 Region: 1376-1417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303575   Gene: FBgn0264089   Transcript: FBtr0330731
Sequence length 1504
Comment pep:known chromosome:BDGP5:2R:11757559:11809623:-1 gene:FBgn0264089 transcript:FBtr0330731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSRTTLMPPPFRLQLRLLILPILLLLRHDAVHAEPYSGGFGSSAVSSGGLGSVGIHI
PGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDF
QRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDIS
NNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIF
GGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEF
KCSGLTEHAPMECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITE
LPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSL
QLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFIC
DCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMD
SDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKL
ELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMP
GSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAARCGAPSKVRDVQIKDLPH
SEFKCSSENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQ
IHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNL
RVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCA
EPEQMKDKLILSTPSSSFVCRGRVRNDILAKCNACFEQPCQNQAQCVALPQREYQCLCQP
GYHGKHCEFMIDACYGNPCRNNATCTVLEEGRFSCQCAPGYTGARCETNIDDCLGEIKCQ
NNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTHYSCDCQAGF
HGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCEGHNMISMMYPQTSPCQ
NHECKHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLRTRPEANV
TIVFSSAEQNGILMYDGQDAHLAVELFNGRIRVSYDVGNHPVSTMYSFEMVADGKYHAVE
LLAIKKNFTLRVDRGLARSIINEGSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSF
KGCMKEVWINHKLVDFGNAQRQQKITPGCALLEGEQQEEEDDEQDFMDETPHIKEEPVDP
CLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVRE
YYTENDCRSRQPLKYAKCVGGCGNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCT
KKCY
Download sequence
Identical sequences P24014
FBpp0086438 FBpp0111745 FBpp0086437 NP_001097334.1.81976 NP_476727.1.81976 FBpp0303575 FBpp0303577 7227.FBpp0086438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]