SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303578 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303578
Domain Number 1 Region: 542-683,739-889
Classification Level Classification E-value
Superfamily L domain-like 2.38e-58
Family Ngr ectodomain-like 0.00000031
Further Details:      
 
Domain Number 2 Region: 75-256,335-495
Classification Level Classification E-value
Superfamily L domain-like 4.37e-58
Family Ngr ectodomain-like 0.0052
Further Details:      
 
Domain Number 3 Region: 1161-1349
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.34e-39
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 4 Region: 1088-1134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000257
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 971-1014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000236
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 928-970
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000264
Family EGF-type module 0.007
Further Details:      
 
Domain Number 7 Region: 1009-1053
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000105
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 1056-1087
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000165
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 9 Region: 1376-1417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000647
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303578   Gene: FBgn0264089   Transcript: FBtr0330734
Sequence length 2157
Comment pep:known chromosome:BDGP5:2R:11757559:11809623:-1 gene:FBgn0264089 transcript:FBtr0330734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSRTTLMPPPFRLQLRLLILPILLLLRHDAVHAEPYSGGFGSSAVSSGGLGSVGIHI
PGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDF
QRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDIS
NNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIF
GGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEF
KCSGLTEHAPMECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITE
LPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSL
QLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFIC
DCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMD
SDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKL
ELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMP
GSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAARCGAPSKVRDVQIKDLPH
SEFKCSSENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQ
IHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNL
RVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCA
EPEQMKDKLILSTPSSSFVCRGRVRNDILAKCNACFEQPCQNQAQCVALPQREYQCLCQP
GYHGKHCEFMIDACYGNPCRNNATCTVLEEGRFSCQCAPGYTGARCETNIDDCLGEIKCQ
NNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTHYSCDCQAGF
HGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCEGHNMISMMYPQTSPCQ
NHECKHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLRTRPEANV
TIVFSSAEQNGILMYDGQDAHLAVELFNGRIRVSYDVGNHPVSTMYSFEMVADGKYHAVE
LLAIKKNFTLRVDRGLARSIINEGSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSF
KGCMKEVWINHKLVDFGNAQRQQKITPGCALLEGEQQEEEDDEQDFMDETPHIKEEPVDP
CLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVRE
YYTENDCRSRQPLKYAKCVGGCGNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCT
KKCYXLKDATTQLLERSNSSLDVSLGTGLNLTYSSSYSNDSLSHSTRDSTDVRGTKDEAE
ESADAGETTEEVRDESDDYPTDGMQSDLYDDTIDDDDDDGLDDDYADEEDGEEDPEQLPD
PKGLVSVPDEEEDMGYDEDDERIAMERPRTVRPRPDEEHFLNEEGSGFGGFRSRFRPSNS
FRETQLENIRKKLLTEAQAAPETAVAVAVPSTAIDLRESSGHFANDDEDGEDGDDGVDDE
FADTGENQGRGFFGSQQQQRKNGPYHRKNGNDAIKIISTPLGKVSIVYQQTDKDQSPDKD
AQQQQQKKPALTDFDALSPDPESSHRFPSPHPKITPVLTPDGKVALLYRGDSESSKYEPI
RNLTHKFSGQPAKESKPKTEDSSSAEDSVYTDSEDTEDSKGETSAGKSSPVASTPKPLQP
EILEPPDNVQPGGSFIIRPTSDSLLPMINRPLSEVLGIKKNQFQETRVRDQLPTQQPPPP
LPEATSRSPASGHQFLAKVNLAEFPTSGRTLQTPLIPSTHDFDFSRDNTMLDERSRVREL
EKQRERDKEHNEATSKGATEAHTIANEQLLSKTEVINLAIVPQFDEDLERLQRLQENGGR
RHHRARHRHRQQSEEELSGIHCIMQVMMGVAAVSTVFGMLGTFFKQRILDQLRMMHW
Download sequence
Identical sequences A0A0B4KES0
FBpp0303578 NP_001261017.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]