SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303613 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303613
Domain Number 1 Region: 180-246
Classification Level Classification E-value
Superfamily CHY zinc finger-like 8.37e-20
Family CHY zinc finger 0.00037
Further Details:      
 
Domain Number 2 Region: 247-304
Classification Level Classification E-value
Superfamily Zinc hairpin stack 1.83e-17
Family Zinc hairpin stack 0.0002
Further Details:      
 
Domain Number 3 Region: 309-365
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000011
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  FBpp0303613
Domain Number - Region: 384-412
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0251
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303613   Gene: FBgn0031816   Transcript: FBtr0331186
Sequence length 433
Comment pep:known chromosome:BDGP5:2L:6459015:6465669:-1 gene:FBgn0031816 transcript:FBtr0331186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNRQRTRRISLNENHNRYMGSGGIDVQIVTNTKEPNQVNLNSSSATTTSAEAALPASLP
LAQIAQQPHTHPHPHPNPHLHQQHQLIVTPTTMTGKYHPAHAKLRRCKSTPSLNCDGMAE
PMEEDQLHRFAACSRNPAAEAQQHAQPSCNSSSSSSDGSCNSNKCSSNICGAQPTTPESL
RFGCAHYKRRAMFVTPCCNKFYKCRFCHDENETHHFDRKTLTELICSECNTRQTVREQCL
NCGVRFGKYTCLICNLFDDADKQQYHCHGCGICRIGGAENFFHCEVCNMCLPIQLKIDGH
RCVENISRSHCPVCLGDIHTSRIPCHIPDCGHLLHKMCFDQLLASGHYTCPTCQTSLIDM
TALWVYLDDQAERMPVPLKYENQRVHIFCNDCHKTSKTKFHFIGLKCVHCGAYNTTQDVK
RRLSLVTDEPSSA
Download sequence
Identical sequences Q9VMD4
FBpp0078901 FBpp0078901 FBpp0303613 7227.FBpp0078901 FBpp0078901 NP_001260133.1.81976 NP_609030.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]