SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303624 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303624
Domain Number 1 Region: 791-856
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000362
Family SAM (sterile alpha motif) domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303624   Gene: FBgn0032330   Transcript: FBtr0331197
Sequence length 968
Comment pep:known chromosome:BDGP5:2L:11013221:11056431:-1 gene:FBgn0032330 transcript:FBtr0331197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQEAATTAST
ATKRKHLERLASDLRQLGKKGRRSRSVSPCSRYPAVAETARMLSERSLLLSGYGAIESSA
KKLSEAATGGAGGGGGGAAGQAATPTTSQLSAPASSASSSSMSSSSAGSTCTTNANTASV
AAAYAAFYLEKVKHEKMDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSSIINNHQSSQPS
LGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSYRGAGGGAGGGVSPSHQQQQ
QQQQQSLQQQQRLSPPSGPSMATATTTSSLSSSSSASASASASASAATHMPLHNLSTNLL
NSIQQAAASQQQLRSSNSNSSSNISGSSNNTKSDGGAASNATDFSTRNYSDIMRCLAAKY
NNANPNDNNATRRNSYYDGSTSATTATGGAGGGGGGAGGSNSAPSSALKTASSSTGSTTT
TAKKLSPSAASAANSAAVSLSKESKVSAVGGAGVGGAVASSGGGGSSMSQLAPPPTAPSP
TEQAKSQMAAVVAAASVSPFMTNFLPFSSGIFPPLIDMSSTQALLTLARAVKDAEIQEIL
RSKQQRSGSNASSPSASAAGTPRSSSTLNAALHQAAQFVTPALIYSAQLQQQQQQQQQQH
QRQQQQQSQHASRQSSPRSTNDSTTVAPIGDGGGGSSIASAAPLDLSSQPPAAKRFKAER
RASSTATTATTATTGSSTSTPSPPPLEQHDDINSGNANATLGTRSGTGTGESSAAGSGAG
VAKARRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQSFRDQSIDGTGLPLLTEDHLVN
SLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLALQTGGAAAATGATAGAGTVTGA
VAGAGATSATTSCSIKSEIFNGGSNGSSSGSSSNQGSDVAAPPAATASSPSSNMLLPVLP
CSGLQDAS
Download sequence
Identical sequences Q9VKL0
7227.FBpp0079750 FBpp0079750 FBpp0079750 FBpp0303624 NP_001260372.1.81976 NP_525101.2.81976 FBpp0079750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]