SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303662 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303662
Domain Number 1 Region: 2547-2615
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000173
Family IBR domain 0.00088
Further Details:      
 
Domain Number 2 Region: 2460-2516
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000789
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 2629-2700
Classification Level Classification E-value
Superfamily RING/U-box 0.000000362
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  FBpp0303662
Domain Number - Region: 681-706
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000259
Family Ran binding protein zinc finger-like 0.0036
Further Details:      
 
Domain Number - Region: 90-131
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00238
Family B-box zinc-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303662   Gene: FBgn0031857   Transcript: FBtr0331220
Sequence length 2839
Comment pep:known chromosome:BDGP5:2L:6759829:6772609:-1 gene:FBgn0031857 transcript:FBtr0331220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTHQLLNKNVRTMPSWVMEANDRIGPKPPPTPPNGVAGGLPKAPALPPKAKSTPEPDYE
IIEFSSQQYSNEPMKTTVIRTKTPDNKLKCTLCGSQNPWVTCAECAGQIFCASCDDMFHK
HPKRKQHMRKAVEQGTPPIPPKAQAGGGAPPPVAPPRRSKRGLLTPFLGRKDQMLPPPSP
TPSHKSLGGWRGSLGGGATPPVPPIATSSANQMNNRPLPDPPRSEGGGSSRSGTPKSVFD
TIQRPPSVQLEKIKSKASATLDRMAILQQRYRQQKARQDLSANSEQAAGAQRRQMSTSVF
NLNSNPRRPLSEAQNGGAWLANQRIQQAQSLAQLNCAGCQQSQQHPGWAQHPHQALPQHQ
HPDQWSQFGSQQQFNNSNLSLNVGPGYMSQQHHPHYPPPVFMTQRGMMPNVYPGAPGYPM
MHPGVMGMPPSAASRAASRSRYAASPTPSRKSMSLRRKRNSYVDDELTDDEDSDQDDRRS
LVSNRSGMTSASRSQHHQNHIQPRQRRLSSASQLIASDELDGDQVHHKMRNRRGSIAKSV
QSEWLPERRENEGTLTRNKTATDSARTSRIYSDLESEGSGARALVQAKIQQKLQEADQHK
SSKKAEPKRKPEMKDENTQAAAVVQKVVVPPAHEESASEYEEVVEEVTASESEAEAQTAP
DPQEVPDEIGADDLGPPPSTPDHEWECEFCTFVNEPNIKICSICCKTPSKPPVQPNKAKK
VEEKPQPPAEKSNNIKASSKTETKPVQKPTTKSQQPSQKSVAALSKTTHTNSTSSSKASP
AVNSKTTSSIPIKTPSKSTLKTSSENESDNSLAKSLLHKESVENIWNTLDESIQAQAEQV
LKKAQKVSTACGGTPPREIAAVEMGTSPPPQSISTQTYDALPFNTKQEEIIPVVPDRFTT
PEPNKMERRPHYRSNSQLQQESERYRSANDLRYHDGFGLDPYSAGLVTKRPNFINELRML
QLQVSSPFDMPHETFGVKHEPARDPETEMHIILKELELYKFTVEELEAALKYCSPETHPI
QWLRENWHKLVQTVQSLSTKYGQERGENTIGTVSQNEAREALRNSGGNVWQAVADCIQQR
QQKYRKLAAKGNFLRDDIVNALTAHQGNVEQALVELNRTQLKPFLMRIWGSPNGVENESG
VAIDTKSDIHDFLNTHALDCLQPPLAGQSPSPAQANPFDQPRTDESPVKSTYATPSPYQM
EDSTLKNLEILIGNMEQNQAKQNQEVLRSIETMLDTFKGKPELEYETDPEIMRILTKSPI
STMKPSGPAEDKSTDDVKNFVWQHIQEIVPNLVQQVEQELMEKPEEVAKIEAEQPKEPEP
LLEPQPEPTPSVDPAVYIMEEVIKPNLREASIREEVQPSFIYATEIANFKLEFDRGTERW
HEAEWESSDLTDAERIVYKCYMAPNEQPKEDVVDVAVESSVNSLPTAKAQEESAPEVPIE
AQKIENTEVTQPETVNEELRQQEKLETPLVITSETISETVSQTANESDKQKSIENNLQIK
QNVAEVQVQSDDQPSTSRDANRRAKRSQQSRKGRSREQSQKPTNRTKLPNNIDQKVNESK
TAAKETEAVKDKDLSAAASNIQSDVTASDPKTSTPLKILSEGTNSNTLETMENVTSTDIN
DNVTIEVISNRSEEVPAIQDLGKTKDISEPTANPIEEITSIQNSTTISEQSEGPQEPEIP
IEVSETTEALQVPREEASIEIVSPPNEEQTKSPTSQEVNIQDTSHIISLPITDVTPTPEI
INIAPSTSSISKEQKQSPKRLSKIPVRTLSSSSLRSESRSSNRTPTANDEIEREETTSQG
VPIGETVSSPKSEQLSDNQEVNLVSQETQSKKDTNIVEEPATQPLGLELEEHSPNATAVA
VSPTDSDEVFEDAPEFSGSDGTRPHDETASDAELYSLDSDGQRAETKSPEDEVVILLDEE
SQMESSIAQSESNASLDSHSSESETSKVVLKEFVPSGDPAKQNLSELVEDTQRLIKQMRD
EISMDEFESTDEDEYSDEYSDEYDEGEEEEWYDSEGEEEGDFDGEEGNTYNEHASYIEEA
STGDEGTEIEDIMEEDEDLADDDEPLQSQIPLDIEPVISPALSVTPTNQETDTIAHTEVV
SSTGTRLETELPNPAMESILPSQSVQEDIKVEAIPIQSAPPIADSETRPAEQPVELVLEI
PSEVEPTPVEEPTALPITPAPPIVDSESRPVEPPVETVLEEPKKVTPSMKGKTANSGTAS
KGPSTSSSTKTNKSTVSKIPKPTNEPTNKSNSTPLNKKVPLRSKSFSAPMGISSVKRIQE
VYLQKQSSSIATSRVPLKSSPVTKKSINDAISRFNSNQADGPSTSGAAAAAAAALLKPRS
QPRIPKKKYHETCFSDDDYETSATEEEQEEPNLAEPQKAEQLKRKMSMPVFRAYPSVQEP
VIEDPAILARKYVDQELVTNIAEAQIAATLVSMKFSEDVALWAARECSDLDQAIAMLQQE
CELCMNSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQH
EDEHLEYFSNLDIFLKSILDNDVHELFQRKLRDRSLLQDPNFKWCIQCSSGFFARPKQKR
LICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQAQGVQEHLAQNGIDCPKC
KFRYSLARGGCMHFTCTQCKFEFCYGCARPFMMGAKCTVSTYCAKLGLHAHHPRNCLFYL
RDKIPLQLQFLLKEQNVKFDTEPMQIKDESSSSSKARAQARCPIPLQKETPQGLVDTVCN
TEVPDKHAGMCRTHYVEYLAGKVAKAGIDPLPIFDLTDCVQELRRRGIALPERGPWDTDE
IYKNMCSEVIKKHIPLKSA
Download sequence
Identical sequences M9PCS0
FBpp0303662 NP_001260159.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]