SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303687 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303687
Domain Number 1 Region: 170-212
Classification Level Classification E-value
Superfamily RING/U-box 0.0000942
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303687   Gene: FBgn0032812   Transcript: FBtr0331245
Sequence length 464
Comment pep:known chromosome:BDGP5:2L:19580612:19582474:-1 gene:FBgn0032812 transcript:FBtr0331245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTEEVKRGRGRGRGTRARGRGRGRGRGRGKKIDDSSIADAAALAASSCAALEDSPGRLD
ASEDSVMQELDKDGELETPGALEEPLPHGALGAVAASGNMTPATQQPQVLQQVPPPVMSQ
TIDMEADISQLEAPTFTTLSRGPPEPMLRLKWNHKVSLIGEKVLNPMIHCCDQCDKPILV
YGRMIPCKHVFCLKCARAEPIKSCPRCTDKVLRVEQSGLGTVFMCTHGGSRYGSSGCRRT
YLSQRDLQAHINHRHVAPQPPPLQPQPQLSAMAEQPKMTDLGGVGLGLELHKQRKLSESS
VPISVSASIASRPVLSRLPLTGGVGNIGSIGSIPPPGSAAAAQNAIHGGHSTLTLANLTR
INNANAQECHQGKASLHHTLKKGTPHQSESVADASYYSSVLASFGSAAGNPGSGPPGGGA
TAAAQPANPSGSHSAVGPGALIGGSTDAPTGGSSGNWQQSQYYR
Download sequence
Identical sequences Q8INW0
NP_788075.2.81976 FBpp0303687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]