SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303743 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303743
Domain Number 1 Region: 566-656
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000095
Family Canonical RBD 0.0094
Further Details:      
 
Domain Number 2 Region: 923-993
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000604
Family Canonical RBD 0.015
Further Details:      
 
Weak hits

Sequence:  FBpp0303743
Domain Number - Region: 361-390
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000196
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number - Region: 7-76
Classification Level Classification E-value
Superfamily PWI domain 0.00562
Family PWI domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303743   Gene: FBgn0002044   Transcript: FBtr0331325
Sequence length 1063
Comment pep:known chromosome:BDGP5:2L:19493251:19497978:1 gene:FBgn0002044 transcript:FBtr0331325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILENSDKLKDWLSVVLEPLCDADSSALARYVIALLKKDKSDKDLKRIMIEQLDVFLSEE
TTRFVERLFDAIASEEYLTVPAAPLITASSASTAELTVDQELALVIDGPQDDIEAVLVAD
SPPPPPKDNVIKPDSNQVKLEQASQDAREAEALAFISQEAGIAMHVPTDAKPAFDQHKTK
DSHNQQSASNYQHHHVRSASPPGRSSGVSGSGGGGPGGAGLAAGYADKENQPRDSRRRRA
SLRSRSRSRSRSNERAFRRSRSRDRRVNEREKTQRQFRNKSPPGSQTDNRHHGRRNFDRR
RIGGNADDRPRFGNNKSRRSHSRSMSPERNARRNQNSPDRVQTAQANLIPAPVAPPAPVE
HPASHPRQRCRDFDEKGYCVRGETCPWDHGVNPVVFEGINNTSLMMSMREYNPDAPEIWA
RSGGPPPGAGQGPVPPPTQPGQTTINPFSGNVRPTTLMSGSGPSPMGVPNPADYARNPGA
PPQAAMMPFPFNPTAVTTPLQRQLIPIPVVDGAPTGGVAEVGKRRFELEDTVAIADVPTK
RKVPINSRLGPRVNPNMQQHNSSLELRKVPRGLNTIAHLNNHFAKFGKIVNIQVSYEGDP
EAAIVTFSTHAEANVAYRSTEAVLNNRFIKVFWHNDSSGADVGQMNQMGGGGGGGGRKNA
SQYHLHNVPAVPTPNADGAKISNANPLTEAGAGNIGTPATEQANTAAPASMRLKLNTTTA
GGSAGGAAGAGAPGSGRPLNPAANAASIRKKQEEQQKAVHQLANGLRKRKQELLQSYMKQ
MKTALELVERMDQQDPQRAPTLQTIKVLQMTIDKLRKEIKADQDQLQAQMQQQQQQQQPP
VKKTKEQQKKELLDMELELIAQQQEGNDTTAIQKRLEELQRNLGVGSAANNKSTHYAPAS
GAPGGGAGRKRPNLPEGPTRVDRRPKAIVVTGFAAEEADFVLGHFKNFGEISKHDVDREI
PQLILSYATRLNAEQAVLRGKMYKDKRLQISWAPVVTPAPAPMAAPVEKSAAPGDMSVSL
ENPKQLIQSVSESESLLGSDTLPELRLEDEEEDEESEDRSWRR
Download sequence
Identical sequences M9PDF2
FBpp0303743 FBpp0303744 NP_001260586.1.81976 NP_001260587.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]