SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303819 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303819
Domain Number 1 Region: 155-393
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.47e-62
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303819   Gene: FBgn0035166   Transcript: FBtr0331402
Sequence length 394
Comment pep:known chromosome:BDGP5:3L:839980:841360:-1 gene:FBgn0035166 transcript:FBtr0331402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSEFLELTQLLPRWVDLENVVRGEVEARYILKRAADHLANLRSGGDSGAEETGYLVGAL
VDRNWERIHTGHFSQVPLVTRKIYAIACCFKSTSPAQKDACSEILDEAQLLGCMEDWSEL
KVALMDYLDKDGAVALNSAPLPTLEPLTRVTSNCDIPQLDAPSLEEFQTKCFEAGQPTLL
LNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSNYASDEWSQQLVKIRDFLSRQFGKEP
SKAGQNIEYLAQHELFAQIPALKEDISIPDYCTISNEDTPGAVDIKAWLGPAGTVSPMHY
DPKHNLLCQVFGSKRIILAAPADTDNLYPHDSEFLANTARIDAAQLDPETYPLVAKVKFY
QLLLQPGDCLYMPPKWWHYVRSEAPSFSVSFWWE
Download sequence
Identical sequences M9PDS1
7227.FBpp0072492 NP_001261225.1.81976 FBpp0303819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]