SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303919 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0303919
Domain Number - Region: 188-203,261-331,360-379
Classification Level Classification E-value
Superfamily TPR-like 0.00144
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303919   Gene: FBgn0037026   Transcript: FBtr0331529
Sequence length 537
Comment pep:known chromosome:BDGP5:3L:20800227:20802347:-1 gene:FBgn0037026 transcript:FBtr0331529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWDSSMFLSTLTPKFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSINHISPWING
SDGQSESSNGSGSSSSSGSSSSSNGGAGGGGSGGAGASGSGSATTSTGTQMPECKVWRNP
LNLFRGAEYQRFFWATSKEPLTYYDMNLSAQDHQTFFTCEGDARKEEYEIMQTAWRERNP
MQRIKSAHSALEINAECAPAYILLAEEEAMTIMEAEKILKTALKVAEINYRKSQATQHQG
AIADGMHRRDTNVLIYIKRRLAMCARKLGKLKEAAKMFRDLTKEIPSIMSVLNIHENLIE
TLLEMQAYADCHAILAKYDDISLPKSATICYTAALLKARAVADKFSPDIASKRGLSQAEM
SAVEAIHRAVEFNPHVPKYLLETKRLILPPEHILKRGDSEALAYAFFHLKHWKQVEGALN
LLHCTWEGTFRMLPYPLERGHLFYPYPTCTECADRELLPAFHEVSVYPKKELPFFILFTA
GLCSITALLALATHQYPEPMGHLAQTVLTWISYPFQLLKERIEAFWPCNLLQQLSRV
Download sequence
Identical sequences M9PFT2 Q9VPB1
7227.FBpp0077930 FBpp0077930 FBpp0077930 FBpp0077930 FBpp0303918 FBpp0303919 NP_001262124.1.81976 NP_001262125.1.81976 NP_649260.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]