SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303946 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303946
Domain Number 1 Region: 264-383,433-456
Classification Level Classification E-value
Superfamily TPR-like 2.94e-29
Family Tetratricopeptide repeat (TPR) 0.0056
Further Details:      
 
Domain Number 2 Region: 186-301
Classification Level Classification E-value
Superfamily TPR-like 2.39e-23
Family Tetratricopeptide repeat (TPR) 0.0099
Further Details:      
 
Weak hits

Sequence:  FBpp0303946
Domain Number - Region: 79-123
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0129
Family N-terminal coiled coil domain from apc 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303946   Gene: FBgn0010235   Transcript: FBtr0331556
Sequence length 507
Comment pep:known chromosome:BDGP5:3L:12739716:12742939:-1 gene:FBgn0010235 transcript:FBtr0331556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDNEKSDMLRKNIENIELGLSE
AQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEK
KHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGY
EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRD
QNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIR
EKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNL
AGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREEHKFDNRENTPYG
EYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEAYDLAKQTKLS
QLLTSNEKRRSKAIKEDLDFSEENAKP
Download sequence
Identical sequences M9PFG7
NP_001261781.1.81976 FBpp0303946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]