SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303960 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303960
Domain Number 1 Region: 619-941
Classification Level Classification E-value
Superfamily L domain-like 2.27e-55
Family Internalin LRR domain 0.04
Further Details:      
 
Domain Number 2 Region: 257-516
Classification Level Classification E-value
Superfamily L domain-like 1.04e-44
Family Ngr ectodomain-like 0.0056
Further Details:      
 
Domain Number 3 Region: 68-323
Classification Level Classification E-value
Superfamily L domain-like 2.04e-35
Family Ngr ectodomain-like 0.026
Further Details:      
 
Domain Number 4 Region: 525-633
Classification Level Classification E-value
Superfamily L domain-like 5.44e-18
Family Ngr ectodomain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303960   Gene: FBgn0036995   Transcript: FBtr0331570
Sequence length 1535
Comment pep:known chromosome:BDGP5:3L:20447790:20457962:-1 gene:FBgn0036995 transcript:FBtr0331570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLLPIFLLLCIGINLIRAESCPPSQAILPCRCSLRGKEIQIWCSHSNLPQIMDGLKAVE
RNIKGRIDELVLENNQLPALPGRFFGSLQIVRLMLRHNSIERVSNGWLNELENGLVEIFV
VEPQLRSIPAESLNGMINMLAITIQSEELKHLPDFSGLLSLTYLSVQTGALQELPSHLFR
HLPKLQHIHITGGSGLTRLEAGLFDGLISLKNLDLSHNGLNWIHLRALSRLPNLVSLKLS
HNQISDVGMVGRIVKDLEHLKKLRLDNNLITVIEDGSFVDLPNLSELHLNDNRITELQYG
AFLRTPQLKTIYLQNNLIRRIHPESLLQASGSGVEAVHMYNNEIGHVEALRALLDALPRL
RYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSLSS
DLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFRHNPLL
ETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPA
AASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLE
LLHLQENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSI
SPTAFDTQRSLEYLDLSGNALLDISVGLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVE
IRLSNNLIVELQQGTFRNLPKLQYLDLSSNEIRNVEPGALKGLDELQEFVLADNKLVELK
DHVFEELPSLLASHFQYNKLRYISPESFHNANSLVFLNLSNNHFRNMENIGLRSMRNLEV
LDLSTNGVKLVSTMPLKALNWLVELKMDNNQICRIQGSPFETMPRLRVLSMRNNQLRSIK
ERTFRNVRGNIAILDVDGNPIDCNCEMQWLSVWLQETNFPYPGPKCQDGRLLRSARMERS
LCVGADIYGNERTDGNQLPLLNEHGDVFQRDLPDDFNDECEAGEGTRLPGDRPLVGESEY
FYDQYVDATEAPDTTHSAISTSQRPKPTPTINSNIDLNNTILHTKYFNRKPQPGSGSPFT
FFGYPLPSVSLGRFFGFGDRGRKQRTDSNDDMPATHRMAHISLPSGRGKTRMYQPNSAEF
EKYLKDQQKQEKLNIARNRYVDTDSTTSSMEDALSNESGSAATTVGVFRTTFREPSSIER
GGFRPIVPAHVGGFMPVHDPQQRRGLVEVVNITGNPSEIVQGIGQRKFIPISTQARPKPT
KSSGESSETATYEVTETTPDITTTTPLMQRIATSTTKASTTTTRSTTTTSTTQVTPAENN
ASSSTELDSQYDDEDLEAQSVTLLRPPPLVQTTTAETILLIPPAEEHVAQIKSRSWVTTT
TPQSPSDNQVTLAGPTSTVPPPPPASPPLRGGGRSTITKVYTPYQQQVAQPTAEEYQRTT
PSGDNEGVASEHQLTANAQKRTELELLQVDRVDRKDGMDWYYESFKKKRDFNGGAAVRKT
AHKEVFYDGVAASSSWNRLHKEILFISLLLLWRAC
Download sequence
Identical sequences Q9VPF0
FBpp0077881 FBpp0077881 7227.FBpp0077881 NP_001262113.1.81976 NP_001262114.1.81976 NP_649228.1.81976 FBpp0077881 FBpp0303959 FBpp0303960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]