SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303989 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303989
Domain Number 1 Region: 511-621
Classification Level Classification E-value
Superfamily TPR-like 0.000000000835
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Domain Number 2 Region: 310-453,516-590
Classification Level Classification E-value
Superfamily TPR-like 0.0000000164
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303989   Gene: FBgn0029878   Transcript: FBtr0331599
Sequence length 685
Comment pep:known chromosome:BDGP5:X:6484809:6490667:1 gene:FBgn0029878 transcript:FBtr0331599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQQLVVLIPKINPNSPKTLYDLSLQALIGSMNTKIPALDRISRLAELPRNLLIDVYEM
MSQQESLKDTLLEELAQLEVFARLVRYPFARSQLLRIMASLMASQKMLAKRLSENYVSRY
EVVAGHEEEELESSMDTVEDRSTEFSSLYTYDSESTNADSISDFNDEFSADIGSIVGLPH
RRATQEELDAINDSGLEELSAVELQVIDLGLRLGSFLSEAGWMQESITVLACLNVRLKDL
PTHKHWLQFRLDCLQRLLYAESAHCNFKEAEKTYAELMGLNKWLNKSVPNQLVAITYSQI
SAMYFARNEYKNSHLWSGLAMRFLKGYANPRTIIDVLRQAAKACVVKRDFARANLLICQA
VRRAREYFGPTHQKYGDALLDYGFFLLNVDSVFQSVNIYKEALAVRRGIFGNMNFHVAIA
HEDLSYAYYVHEYSTGDFSCAQDHVDKAVNIMQHLVPSNHLMLASAKRVKALLLEEIALD
KMADGIDEEDLLLQSEELHNFALLLSLQVFGEVNVQTAKHYGNLGRLYQTMNRFEEAERM
HKKAIKIKSELLGHFDYEVGLSIGHLASLYNYQMKKYRDAEQLYMRSIDISLRLFGNSYS
GLEYDYLGLCHVYETLHNFEKYLKYAHKLENWQMLRGQNLTQNSSYPAIEVDYSIEEVKA
KYFSMCASKKSAHPSVHEEDTVNEN
Download sequence
Identical sequences M9PGT5
FBpp0303989 NP_001259285.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]