SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304027 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304027
Domain Number 1 Region: 6-68
Classification Level Classification E-value
Superfamily RING/U-box 1.1e-16
Family RING finger domain, C3HC4 0.0000688
Further Details:      
 
Domain Number 2 Region: 102-189
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000806
Family Canonical RBD 0.0000948
Further Details:      
 
Weak hits

Sequence:  FBpp0304027
Domain Number - Region: 191-220
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00169
Family CCCH zinc finger 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304027   Gene: FBgn0051716   Transcript: FBtr0331637
Sequence length 1054
Comment pep:known chromosome:BDGP5:2L:10397179:10402882:1 gene:FBgn0051716 transcript:FBtr0331637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGLSSNDDAVECPLCMEPLEVDDLTFFPCTCGYQICRFCWHRIRTDENKLCPACRKEYP
ENPADFKPLSQEEMIAFKSQKRQRDQQRKQKITENRKHLANVRVVQKNLVFVVGLPPRLA
DADILKKHEYFGKYGKIHKVVINPSTTYAGVQVRVGPSASAYVTYVNNSDALRAIQSVNN
IMIDGRLIKTSLGTTKYCSHFMKNQQCPKGDCMYLHELGDPEASFTKEEMHQGKHLEYEK
RLHDTLIASLGPNATGIVNVAIPSSSSASSSSSGSGTNGSSASGNAQQKEAWPSLSVSPI
NGKEAAATATSSSGKSKREKLRNEKRHEKNKAKNKNGSNTNANASNKENYVPETRSSTST
ETFAEATADAPASTKAEPPQASSNRTRADRGKDRTTASAKEQKKSKEAAPAPAASKPAER
VETSESTIRQKKAEVTESCEDNLPQKRLAGTNVQRSVSSCSENSEGHVSESSLSEKSLTG
DYVEEKCNSVNSESQQESVKFQEELEKSNEAIVEAETILPTAESSEDISPAAVAPGNGEV
EGCLPVVDPVEPPSLADNGSRVTDALSKLNIFDDTPSFFTSPSFQQAPILKNKLDLEMRQ
SHLPDLVNDIDGIQKASNTNEWEEAFKNVMMGNTQHMEEQLLQQQHLQQHQNLRHQLVLQ
QEEFLRMQELQKRNNFATQINGPANDFLRAYELRAQANAIIQQQLLQQHAGENLFGGNMS
KFFDFHKSQPQSHHQYLNGHPPQINGNGAVPEPQRVAASLESNRLNSPFVENGLINSQQQ
QQQQQQQQKQRMMGMYEFMPPNTQSQQNRFTQNSIVDDDLGFDPFVETQKGLAELMENEV
VQKQSINNENPLPKLPPQPQVPPHPQLVDNLQRARMPPPGFNHVNTLGLGGASRLQLTSK
IIPFMNMPVNGVGNSGAQGQHQMPMGVNWNAPMGMHQNPGQPVGDSQLQHPMAHNKVYNN
SDWTSMDPAILSFRQYSSFPQNQIPPHPQQQQDLFLQHLAQQQNSQSGGFNNQAQQMLPM
GMPNSLLNGQQTQPPQVNANVQGMLEFLKSRQFV
Download sequence
Identical sequences M9PFI0
FBpp0304027 NP_001260342.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]