SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304028 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304028
Domain Number 1 Region: 6-68
Classification Level Classification E-value
Superfamily RING/U-box 1.1e-16
Family RING finger domain, C3HC4 0.0000688
Further Details:      
 
Domain Number 2 Region: 102-189
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000819
Family Canonical RBD 0.0000948
Further Details:      
 
Weak hits

Sequence:  FBpp0304028
Domain Number - Region: 191-220
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00171
Family CCCH zinc finger 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304028   Gene: FBgn0051716   Transcript: FBtr0331638
Sequence length 1062
Comment pep:known chromosome:BDGP5:2L:10396716:10403206:1 gene:FBgn0051716 transcript:FBtr0331638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGLSSNDDAVECPLCMEPLEVDDLTFFPCTCGYQICRFCWHRIRTDENKLCPACRKEYP
ENPADFKPLSQEEMIAFKSQKRQRDQQRKQKITENRKHLANVRVVQKNLVFVVGLPPRLA
DADILKKHEYFGKYGKIHKVVINPSTTYAGVQVRVGPSASAYVTYVNNSDALRAIQSVNN
IMIDGRLIKTSLGTTKYCSHFMKNQQCPKGDCMYLHELGDPEASFTKEEMHQGKHLEYEK
RLHDTLIASLGPNATGIVNGNGASKANVAIPSSSSASSSSSGSGTNGSSASGNAQQKEAW
PSLSVSPINGKEAAATATSSSGKSKREKLRNEKRHEKNKAKNKNGSNTNANASNKENYVP
ETRSSTSTETFAEATADAPASTKAEPPQASSNRTRADRGKDRTTASAKEQKKSKEAAPAP
AASKPAERVETSESTIRQKKAEVTESCEDNLPQKRLAGTNVQRSVSSCSENSEGHVSESS
LSEKSLTGDYVEEKCNSVNSESQQESVKFQEELEKSNEAIVEAETILPTAESSEDISPAA
VAPGNGEVEGCLPVVDPVEPPSLADNGSRVTDALSKLNIFDDTPSFFTSPSFQQAPILKN
KLDLEMRQSHLPDLVNDIDGIQKASNTNEWEEAFKNVMMGNTQHMEEQLLQQQHLQQHQN
LRHQLVLQQEEFLRMQELQKRNNFATQINGPANDFLRAYELRAQANAIIQQQLLQQHAGE
NLFGGNMSKFFDFHKSQPQSHHQYLNGHPPQINGNGAVPEPQRVAASLESNRLNSPFVEN
GLINSQQQQQQQQQQQKQRMMGMYEFMPPNTQSQQNRFTQNSIVDDDLGFDPFVETQKGL
AELMENEVVQKQSINNENPLPKLPPQPQVPPHPQLVDNLQRARMPPPGFNHVNTLGLGGA
SRLQLTSKIIPFMNMPVNGVGNSGAQGQHQMPMGVNWNAPMGMHQNPGQPVGDSQLQHPM
AHNKVYNNSDWTSMDPAILSFRQYSSFPQNQIPPHPQQQQDLFLQHLAQQQNSQSGGFNN
QAQQMLPMGMPNSLLNGQQTQPPQVNANVQGMLEFLKSRQFV
Download sequence
Identical sequences M9PB92
FBpp0304028 NP_001260343.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]