SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304029 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304029
Domain Number 1 Region: 6-68
Classification Level Classification E-value
Superfamily RING/U-box 1.1e-16
Family RING finger domain, C3HC4 0.0000688
Further Details:      
 
Domain Number 2 Region: 102-189
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000806
Family Canonical RBD 0.0000948
Further Details:      
 
Weak hits

Sequence:  FBpp0304029
Domain Number - Region: 191-220
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00169
Family CCCH zinc finger 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304029   Gene: FBgn0051716   Transcript: FBtr0331639
Sequence length 1050
Comment pep:known chromosome:BDGP5:2L:10396716:10402882:1 gene:FBgn0051716 transcript:FBtr0331639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGLSSNDDAVECPLCMEPLEVDDLTFFPCTCGYQICRFCWHRIRTDENKLCPACRKEYP
ENPADFKPLSQEEMIAFKSQKRQRDQQRKQKITENRKHLANVRVVQKNLVFVVGLPPRLA
DADILKKHEYFGKYGKIHKVVINPSTTYAGVQVRVGPSASAYVTYVNNSDALRAIQSVNN
IMIDGRLIKTSLGTTKYCSHFMKNQQCPKGDCMYLHELGDPEASFTKEEMHQGKHLEYEK
RLHDTLIASLGPNATVAIPSSSSASSSSSGSGTNGSSASGNAQQKEAWPSLSVSPINGKE
AAATATSSSGKSKREKLRNEKRHEKNKAKNKNGSNTNANASNKENYVPETRSSTSTETFA
EATADAPASTKAEPPQASSNRTRADRGKDRTTASAKEQKKSKEAAPAPAASKPAERVETS
ESTIRQKKAEVTESCEDNLPQKRLAGTNVQRSVSSCSENSEGHVSESSLSEKSLTGDYVE
EKCNSVNSESQQESVKFQEELEKSNEAIVEAETILPTAESSEDISPAAVAPGNGEVEGCL
PVVDPVEPPSLADNGSRVTDALSKLNIFDDTPSFFTSPSFQQAPILKNKLDLEMRQSHLP
DLVNDIDGIQKASNTNEWEEAFKNVMMGNTQHMEEQLLQQQHLQQHQNLRHQLVLQQEEF
LRMQELQKRNNFATQINGPANDFLRAYELRAQANAIIQQQLLQQHAGENLFGGNMSKFFD
FHKSQPQSHHQYLNGHPPQINGNGAVPEPQRVAASLESNRLNSPFVENGLINSQQQQQQQ
QQQQKQRMMGMYEFMPPNTQSQQNRFTQNSIVDDDLGFDPFVETQKGLAELMENEVVQKQ
SINNENPLPKLPPQPQVPPHPQLVDNLQRARMPPPGFNHVNTLGLGGASRLQLTSKIIPF
MNMPVNGVGNSGAQGQHQMPMGVNWNAPMGMHQNPGQPVGDSQLQHPMAHNKVYNNSDWT
SMDPAILSFRQYSSFPQNQIPPHPQQQQDLFLQHLAQQQNSQSGGFNNQAQQMLPMGMPN
SLLNGQQTQPPQVNANVQGMLEFLKSRQFV
Download sequence
Identical sequences M9PCL9
NP_001260344.1.81976 FBpp0304029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]