SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304061 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304061
Domain Number 1 Region: 147-312
Classification Level Classification E-value
Superfamily L domain-like 9.69e-26
Family Internalin LRR domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304061   Gene: FBgn0010398   Transcript: FBtr0331671
Sequence length 428
Comment pep:known chromosome:BDGP5:2L:10517335:10519269:1 gene:FBgn0010398 transcript:FBtr0331671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKILCEVQVVNRATQTNKTPRPVKSTLAIGYKQSARDANGNTKKELEMVLFSGQNKTGNR
YKVKDNIHVVHTKFVLDGKTTIGFIQPPDNLLIKCDPIQLKGFLQTLKLGMDGKDAINLR
LNINAATAIPQKAQPQVRMVISKRSEYPIKGFPRTLKSLTINNSQLVKLSFEICTLRNLT
KLDVSGNKLTKIPSELGRLPLTSLHLGNNLLGTQNDWCWLRGTKLCQSLGELDLSGNGLT
YFPPPLVKFESLVSLNLNNNLLSRLPFAIRRMKALRKLYVCSNELESLPSAVEDLRIDLL
DVWGNCFKEFNADAAQQMYLQKAASNSPQPLWLLGARAVDKYMLPLSAGSIPAVLIDLIR
EAPRCPCGELCYAQRKEDLFQRVVQPKFITVKNLTYSREHQIYADVVLCDSRCSASAELK
LLFNIIFS
Download sequence
Identical sequences Q9VKU0
NP_001260355.1.81976 NP_523539.2.81976 FBpp0079681 FBpp0304061 7227.FBpp0079681 FBpp0079681 FBpp0079681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]