SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304082 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304082
Domain Number 1 Region: 191-515
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 7.38e-105
Family Protein serine/threonine phosphatase 0.00000000197
Further Details:      
 
Domain Number 2 Region: 49-161
Classification Level Classification E-value
Superfamily TPR-like 1.02e-29
Family Tetratricopeptide repeat (TPR) 0.000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304082   Gene: FBgn0005777   Transcript: FBtr0331693
Sequence length 520
Comment pep:known chromosome:BDGP5:3R:5573849:5576822:1 gene:FBgn0005777 transcript:FBtr0331693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSELEVQKAADCQQEAKVPASVEITGSKQPEEDTNARTKAELDFAAAEQYKNQGNEML
KTKEFSKAIDMYTKAIELHPNSAIYYANRSLAHLRQESFGFALQDGVSAVKADPAYLKGY
YRRAAAHMSLGKFKQALCDFEFVAKCRPNDKDAKLKFTECNKIVKMRAFERAIAVDKPEK
TLSEMYSDMENITIEDDYKGPQLEDGKVTLKFMKELMEHYKAQKRLHRKFAYKILCEIDT
YMRAQPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGLPSEKNPYLFNGDFVDRGSF
SVECIFTLFGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYTSAMADIFTQVFNWL
PLCHCINQKILVMHGGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSDPQQWMGLGQS
KRGVGIQFGPDVTEKFCKDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDTMGNM
GAFITITGNNLKPNYKSFEAVPHPDVKPMAYANSLMNWLA
Download sequence
Identical sequences Q9VH81
FBpp0081606 FBpp0081607 7299242___KOG0376 FBpp0081606 FBpp0081607 FBpp0304082 7227.FBpp0081606 NP_001262433.1.81976 NP_524946.1.81976 NP_731398.1.81976 FBpp0081606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]