SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304085 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304085
Domain Number 1 Region: 8-43
Classification Level Classification E-value
Superfamily SAP domain 0.000000275
Family SAP domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304085   Gene: FBgn0039229   Transcript: FBtr0331696
Sequence length 279
Comment pep:known chromosome:BDGP5:3R:20643186:20648072:1 gene:FBgn0039229 transcript:FBtr0331696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEAGKKIAELRVCDLKSELEKRELETVGPKAVLIERLEKSLRAEGLDPATHLIVPGAKA
KKPFAMPMKDLQSEVVIKEEPIDANEEEVKVEQQDDYQNGNDYSHHADDDGHEIDQVGDV
DDECVILDDDDEEDEDHVYDDEPQSGDGDAEGKAQDDGAENNGDDKAIIHGEEENTGDTG
NMDNDESINLTIGEDEQKLLHDEASDDKSIKSVKPANKSEKSNSKDADKKNDDGARSKKR
DEKSGDKKDSSEQKSSGKSSNQKDDKGSWSPAMILASAG
Download sequence
Identical sequences A0A0B4KGV9
FBpp0304085 NP_001262931.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]