SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304250 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304250
Domain Number 1 Region: 129-323
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 5.77e-22
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304250   Gene: FBgn0035211   Transcript: FBtr0331866
Sequence length 330
Comment pep:known chromosome:BDGP5:3L:1333239:1334576:-1 gene:FBgn0035211 transcript:FBtr0331866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLFISRPTRTLGNRMQAVRERLGPDLADQLDALHRNVMRTGLVSTQELEEAFRKTRDMD
HNPNRLNLLWLLGIVFFIMVATPVFYETISFLLGVRCFLPNNYLVWEATRPISDCEFCKG
VRAPLILANLTMEEFAPHAYSSMPIIVKRAVAHWPAQKNLSFAFIKELYESVPGAMDSDC
QFLHFNSDLKSLKHVFSMSAERSNLTQGVPWFVGWSVCQPAVLAELRKLYPRPHFLPFDA
EMPHTDFILMGYEQGAVMHLDYIPRLLWQAQLSGNKTWFLAPAPECDHQCQPFSFYVEPG
DAVLVDTRIWYHANSIPKGQFSLTVQSEYG
Download sequence
Identical sequences Q8MSC8
7227.FBpp0072607 NP_001261251.1.81976 NP_612102.2.81976 FBpp0072607 FBpp0304250 FBpp0072607 FBpp0072607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]