SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304360 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304360
Domain Number 1 Region: 172-288,507-660
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000578
Family Ngr ectodomain-like 0.057
Further Details:      
 
Domain Number 2 Region: 429-618,714-910
Classification Level Classification E-value
Superfamily L domain-like 0.000000646
Family Ngr ectodomain-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304360   Gene: FBgn0052107   Transcript: FBtr0332050
Sequence length 988
Comment pep:known chromosome:BDGP5:3L:12850382:12854408:-1 gene:FBgn0052107 transcript:FBtr0332050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAKFETMMEYFGLEEKTTIFNLNPYCLYEIFRQIHKNCAFKQTNDIFLKYSDLINFAI
CCDHLNRTFKKWSLNLYKELCIENTFLNTYICVEINFSNLHSHIYGLSNSEKKMFWMNFK
NHIMDNEQLESLKVIYEPTRYWSDYLERFEDLIKSLHVKPKLRELSVYINGFSLEIVPQI
THLEKLELNVRMHSSILVELCKLNPNLRRLILRNSEIFGRLSDIVPHCNQLEYLSFVMKE
VDASEYVALANLPQLKSLILCGEHLEGSLVKLFNRFQEHQHIQSICIPETYVSNAEAIAL
ASIRLVVSIKCCLRDKSIYSDLPLSGKLTHIYILGHPMQYNPDNPYYNEKEEDFLKVTYR
AHRPLAVVRAYYQYWQTKDPNLLQLAFDEDYLHAHRLYCIGWYDAKILPATMHNSSEQFS
VSITGIVLNKKVSISDAELAVLASIPTLTTIRCSFVQIEQIIAVKLQQLNEITNTANRVD
KIKTEFCNIRFVHSHESVTLVLEFFVQCILSYGSILAPLANLRNLKRLEIKGKLMSGSLV
ELFRALAALDKHTLQQLETAFLDPEELEEVVKIQSLRILKSGFFCSKYINELGNLEQLEE
LTLIVHPQGSLIELFAVLESKQPQVLKRLVIQNAKLTKQEVGHLAGIRSLESLQLGLPEV
KYWEQQLKDTKNQAFVNYCQKCLLAPVSFTYENQTHQTDIHTLITATDEDPLDAQFNFLT
QSYGTLTPTNLALLANLPNLKELKIYFNYNTLDAVNLLNTIALQYPQKVRTLAFASQDFR
LVSLFKDLQSFECVFSHIKDIEYISQLRNLTDLQIDNPLGISLWQLLKELKVLGNLQSLI
LDNSNLEFLELVEVTKLSWLKRLRLGLAKKQFIFMLIQLEDLEVLEITSTHYAAENESNF
LYSFLIKCKNIKSISLYRFYDFLRKDYINGILNHIKLFRNPYEHPPFKLRGVWSDFKRFN
HLACYNNELMELRRQDGSYQSSDESDED
Download sequence
Identical sequences FBpp0304360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]