SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304413 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304413
Domain Number 1 Region: 2553-2662
Classification Level Classification E-value
Superfamily Bromodomain 1.02e-35
Family Bromodomain 0.0000421
Further Details:      
 
Domain Number 2 Region: 2492-2546
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.87e-16
Family PHD domain 0.00065
Further Details:      
 
Domain Number 3 Region: 2436-2491
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000332
Family PHD domain 0.0016
Further Details:      
 
Domain Number 4 Region: 335-391
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000399
Family PHD domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304413   Gene: FBgn0000541   Transcript: FBtr0332103
Sequence length 2668
Comment pep:known chromosome:BDGP5:3L:233926:246912:-1 gene:FBgn0000541 transcript:FBtr0332103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGSRKRGRPPKTPNERASGRFNYQLLKKPKYLSEGKSQPSTPSASRGISPQSDEGSR
SSHNNHTNRSRGSAAKRGRGRKSAVQPNTSSYSGRKGYESEYHYGSDFGDSEEDKSDNED
DMLLTPSDDESLEVANESESEFSVCSFNQNGVGRPPRPPSPEPVWLQEGRQYAALDLPDS
SEDLFIANTHVLRALSIYEVLRRFRHMVRLSPFRFEDLCAALACEEQSALLTEVHIMLLK
AILREEDAQGTHFGPLDQKDTVNISLYLIDSITWPEVLRSYVESDKTFDRNVFHILSHTE
YPYTGIDNRLEVLQFLSDQFLTSNSIRDVMLQEGPIHYDDHCRVCHRLGDLLCCETCPAV
YHLECVDPPMNDVPTEDWQCGLCRSHKVSGVVDCVLPQEKQGVLIRHDSLGVDRHGRKYW
FIARRIFIEDQENFTCWYYSTTSKLKLLLSRLDAEELETRLHSQITERRDEIERQMKLTE
TLTNEHKHTKRSVIEIEQEAKNELLEKEVLDEDEKDGDAKSESQSIEGTKKQEECKMVTR
QKSNQLTNGTLHFKLGMEQGFKNYVNQYSTNPIALNKPQRNEERDKRRHLSHKFSLTTAS
DFKWIGITMGTTDNMITTLRQTLINFESNIAASFLNINWVVNKKIWNAAVMNARRPSEFA
VVLLLFQASLKSVVFANVWHEQLGHTTLQRITSAEREERKKLEKREKRERDDEEERNRLA
FNYIKYTLGLKHQVWKQKGEEYRVHGQWGWLWLSSSRRCGVRARRAQPLTHNRVYVHYTM
GEENDVNEIILVDPRTQRFMQQCESSNVDGQVCHYLPDQYKNVKVIEDVTEKIKGHIDVS
KALNAPGRTYYSKVARKSRLDDLLDRRLKLAEVEEQMASKIPSDMKPLLVSSQNNTANSK
QTFLEKRLLRLTEVQAKGGPANVNLELVNSLAKQIQTVRLQFSQLNRFAKVFRCYTKECN
TNSNAVSQITQNTCYSPLCLQKARAKKELLLLLRKAHTAGNGSKETVAAILGAVKKPSIL
EQKLTEGKRESTQVAVDDSEEGKPAESEAPLDLLQDWEHARAHAVPFSDSLLTECILVDQ
ECVTNTKIKQEVNASSGCNTTPDSNTQDSDKIDYIESMDVCSNVEIESTEDSIVTGLNSG
NAEDVDMTPGWRRKRNQKSKKSYIGTKDVLDQTLDKDIPLNKQNRRFPITARPVKRECVK
KYERETFENGNERVYSTSSPRGRVYLLNDAAKLYEQAVKTEDKSTITKKPSYSRYPLISN
FLTHKKKRSLLVLPRFELLKLARLGGKSSTNGFHHAAKNNTIWQYQCSRPLFRTCWSYRT
SNATSLSSLALQLRILWSCLRWDDMIAKPPSTDGKHQVTTDTEIVTLELLKLRHSGRYGE
KTSYLRRKVVIPLEMPKTVRVTSIRSGLRKRKRAESPQPTEPQITEEWVDEDKLELWEIK
FMGEKQEKARLSAVTRSVASRQLEASGSNGSNTSTNGALGVAGRVQLAPKLSEDVKEKME
QQLKLQRAVHQQRKLVATGEITRSVTPVKGQVIGSRRVIVKNPDGTTRIIQQAVTQVSRT
GGANTAAAAASPTVGGSTSTQSNPSTSTPHKVQIIRGPDGKVSVRGLNPGQQLVQMPDGK
LHVLTTTTSSNSAGQGNKMKVPIKPASTSSSPAISSAQTTTNPVTPVIKQIAVKHVTKNS
ATQSIASSSRVALPLAQIKNKLLLAQQQQQSTSSSPATSSSPVQKIVSKVVNTSTSGQTL
QQVFVQSGSKLVVGQNAQGQKVIISTSAAQQQGTSPVQQQQLVQSQPIQQSPQQISMTQV
GNQPTQKVIQQIVNTSNVQQQIVVGGQRIILSPGQTIVTQRNVPQSQALQMVQQQIQTQQ
QQQQHHVVQPQQQFVVQSNQIVQSSPSAQTKLVKQLVVQQQSQQTIEEKTQITTTDSNET
GTQQVLVPNSTLAQQLAQGKLQVATVNGQQVIVKPLGNNQAQIVAHIKHQGDGNAHIVTS
NSATAVPQANPQTSPVKQQALPPQSPQQVVVQQQQIHQQSPTNFESGVTPITQQPVLTQA
VQAPAQQQALSVEESLLQNQPPGTVIKCVTAQVLQTEHGPRIVLQGLVGNDFTAQQLQLV
QTQVKQQLMKAQESNGKLGVLGPTKIYLAVQPENAVQSQPPPLTPVHQSAAHQQTNNIEI
DADTLATTYEANSTIKDIAINNGDDQENSKCAETENSNITTNESFAGTSSLLEGSEHDEP
TNLAGLDISETDLENKQNESFVVTRGYIQKSISNALKQGNLSPELEEKLVCMQKQQENAN
STNEWETCSRGSVNEEALTPSRQTDDTEWKIRTSLRRPNAMTTSSQFNRILKKNRSKNDE
VAELGEQKQSQLERHKELLKKNILRKRSLLERNLQSEIHEDVKTKVQRHVRPLSNASPDE
QSENERSGEPNLDFKRTEVQNPRHGAGRPKKLTRKKEKLYCICRTPYDDTKFYVGCDLCS
NWFHGDCVSITEEASKKLSEFICIDCKRARETQQLYCSCRQPYDESQFYICCDKCQDWFH
GRCVGILQSEAEFIDEYVCPECQRKNDANAANMKKLTSNDVEELKNLIKQMQLHKSAWPF
MEPVDPKEAPDYYKVIKEPMDLKRMEIKLESNTYTKLSEFIGDMTKIFDNCRYYNPKESS
FYKCAEALESYFVQKIKNFRENVFDQRT
Download sequence
Identical sequences M9PE12
FBpp0304413 NP_001261189.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]