SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304429 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304429
Domain Number 1 Region: 1697-1789
Classification Level Classification E-value
Superfamily Immunoglobulin 1.87e-23
Family I set domains 0.0018
Further Details:      
 
Domain Number 2 Region: 1489-1582
Classification Level Classification E-value
Superfamily Immunoglobulin 8.26e-23
Family I set domains 0.0019
Further Details:      
 
Domain Number 3 Region: 3566-3657
Classification Level Classification E-value
Superfamily Immunoglobulin 8.35e-23
Family I set domains 0.0029
Further Details:      
 
Domain Number 4 Region: 1388-1481
Classification Level Classification E-value
Superfamily Immunoglobulin 1.58e-21
Family I set domains 0.0041
Further Details:      
 
Domain Number 5 Region: 1811-1905
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 6 Region: 1589-1677
Classification Level Classification E-value
Superfamily Immunoglobulin 2.9e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 7 Region: 2236-2327
Classification Level Classification E-value
Superfamily Immunoglobulin 3.87e-17
Family I set domains 0.0073
Further Details:      
 
Domain Number 8 Region: 1924-2017
Classification Level Classification E-value
Superfamily Immunoglobulin 3.75e-16
Family I set domains 0.0049
Further Details:      
 
Domain Number 9 Region: 2142-2233
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000022
Family I set domains 0.01
Further Details:      
 
Domain Number 10 Region: 503-643
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000245
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 11 Region: 133-208
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000273
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 12 Region: 280-436
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000484
Family Spectrin repeat 0.022
Further Details:      
 
Weak hits

Sequence:  FBpp0304429
Domain Number - Region: 936-1095
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000299
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number - Region: 209-332
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0202
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 643-741
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0691
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304429   Gene: FBgn0052311   Transcript: FBtr0332119
Sequence length 3664
Comment pep:known chromosome:BDGP5:3L:2122619:2151700:-1 gene:FBgn0052311 transcript:FBtr0332119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRQALDSSMSSLYSVASSSNPNPRQPHTGHQLQTQQSQQSQQSQLDAFNYSATMSSSS
PTPSQAMSTAMSTGTGTGTGTTHTTPPSSSSLRATTIGTVVVRCGPIQLVIALLQSPEKI
YIKVVELEPKITALGENLDESLRMQREHDETLRNLQSLPGPMDEFVQKADKLLASKRISS
ELVNAMADTLNIIWQDILNLLQDRQHLLILCTQFHDKMTQCFRKMDQLELACEETLHPPD
VPRVQEFLNRFKQLRIDMLTGVMAALKDGNELLAQLEELEKLETLDTRPEHIKRDATRAV
HQVQQWLEALHDRRNSLELAWQTRKIQMEQCLALALLGRELVDLEAALQQARMELNTMYS
LGECEHTANEMLTKYREWKQQALLLRDRALKITRAKEKVQSAGHFTEEDACARAYAVLSG
CTEHLDLVDQREHWLHQSREFFAKAEHTVSVLEKLELELTSVKLPPHSPESYAMFSKVDR
DVRNFTEEPLRLGYGILDEVGRTQPETQGVKRVLDELENRKVYIQGICANSSEDQQKVQR
ALSEFLNHHNELLAWLRASGQHQLQQSVDMGGNLQQAKQFLLQHHELMQDLEIKGELINL
LLESIKVHLESLSPQERYDVDSKAESLHKHWIELKDLVLKRVDYVSLLIDFFELANELSS
QLDNLQRQLQQTPDEHKLQFLQATWTGIASTFGELKSRGQRFINLKIVDPYLETKSSAQA
VQETLNDFSKRQVDVTSSLENWTTSIAEKREVEYLLEKVMSDNEETVAKSTQVDTQLYPV
FTSQSVDSKQLLISTREKLTNVIQDIERAQDEIQQRIQTTLGIQTKDQPSLAKIEQVINN
LRMLKAKLDGIKYDYRTLVESVIQFLENIVQLRREIDDYFARQQKEPASGADRSIAEHEK
FRDQCMDKFRSLITQSELLIDRVRVLEPPGAREIDTDRILKLLENLRLHFESNSSARMST
LERLEKIEQFRSDLEDIDRSLDSVSQQLHEINNQSVDSLAAAKTTSLAFEYFERTIECSM
PRQLKSTRHQRRWGQTAHTIELLEKRIEKFTESTSQQLFITNPESERYVKDELRKLNEKW
QSFKDQVKQKRKSLNQATDFFEVVEKIDAEYREISYFYTSVSNKVPYLRDSVEAGNLVND
IENYVTSREAALRSKLDSASQCAHDMNKVSSLYNDVMNIFQSFIKLKMDINVVQERLKQE
QRQKEQRERDARDQAEREKAIKEAEAKERLHREEQSRLENQRQQAAIEQAQRELAARELA
LREQAVREEEARLQAIREQATREQLAREQAAREEELRIQSLRDIARREEEVRLQNIRDEE
TRIRREEEERIRRENESRSKREEEARIQREEITRLQTLRDQVDQQRIVTENIRKDIQVNS
IFTELRYASPLFTRPLKDAVSREGDRFVFECEVTGTPEPAVEWFKDGISIQTNSDYKTTF
DKGICRLVIEETFAADSARFSCRASNLVGTCDTNATLSVRENAAEVQLVPPRILRFLQSG
KATEGSSFQFACVVAGVPLPTVQWFKNDKCIDDSPDYVISYNNGEATLKFEEVFLEDDAV
YTCSASNPAGIEHCSASLIVEPLEPTELPSFKVPLSNAMARVGQKIKLEAIVGGIPRPEV
YWLHNGKPFQPRDSKYEYGRVTLIIPQAYPNDAGSYVLSAKNLAGEAYTSCNVIVKGRLP
NETSDSEMASDIEPIKPAVHLPLKDVSIFEGKPVRLDCVIVGQPEPEVIWYHNERPVKES
ADVQLLFQGDRCSLIIQEVYQEDAGHYKVVAINSAGEASSSCELKVTPLNQAEPATRAQA
ERQSLPKDSQPKFERLLSDVLADEGEQVVLEVQASGDQPLTAQWFLTNKELQLDQRITTQ
SDSELGVFKLILNNVSGDDKGVYTVKVTNPAGDAKCFSHLIVKSVNAPENRRSSQSSVEI
IERHQCPEFKELFSDKQGEIDEVIKFECIVKGKPTPKVHWFFNDQPVHGHNFLVSTSGER
QVLTIQKLTHDAVGKISCVAENEAGKATCVAFLNIRGSGLPASSDVQTVSQEHNTESSRV
TIKKQTFTTTSTSQVNSYEGNAPQTEVHHSSAHIDQSLKQLGQQRPEIVESHHYQELHKS
KEMSSPTVQQKSFSFIQSSGANGQSAVAIPDSPTRLRREIAPRFTTPLSGKIVDQGADVS
MEAIYDGFPSPEIKVEKNGGQLFEDAHTRISNKCNRVTIELKQVGVGDAGRYAVTASNTV
GQSTSTADLVVKKTIFPPVFGRRLQAQVSKKGEKLTMEVEVTGLPEPTVTWLKDDKPLKD
AGISEHRLLAQGNSYRLIIEKAQTTDSGKYMVRATNAGGEAKSIADCAILEPSPERLQEV
VKTIVYETGPVAPASEFKTEVQKQIQNSENQQSYQNSQTEVTSANDLHGLSESKVITEHR
CTTEATMRLEHKSNYLDLPELTTRPKTPTTNDTITITTNTATVSMDQPDLTQPTITNTTT
TNTTKVPPPVPPKPCTPVVATTFGQQQQQPPQTLTSTRYEQSEHKSTTSSSSFDYFKKID
EETIIQRPNPLTFKPLDTVVRQPQAQSLAEELRSLNLIPGDAPEFCYSPKTERSEPKIPL
ITEKIKILSEVQPKEPPPQGGVPVFPPPLGLQTVQHESTTTKEVKVEYGQPIVRPAAVLA
TPAQQNPRSPSPKPSAEGVAMSRLWTPTGVTGYTSDVEQKSEKTVISKLATPTPTKELNA
PFLVNQIAKSIPPTTAPVTHLVNVELEPGTPPEICFAPKVEETRRRSLVETMEQKLEQNL
IQGPSKVLPHSVPTLTPNTAAPVQPKPLGNTTYRPPPPVLPTRLGVYESDYESDRYKYSG
SESDVEPGIRKQPQLTTMETSFKSSGYTADTEEHSSYRKSESSFYETKSSSTMGGAPQLQ
TQFPKLQPEPPAPIYFTAKPQPQVPPQVPPSQSNVSSQEAKGYKYTSSSMTSNYSHNMQS
SSSSSHHETKFSSTSAPPPVVTYPSPIPAQRKTPAAEFSDYSSEIDERFRSVSRANESDA
EIKGYRVVFPPTPTPRTNIATNGHKSPVVVITPSPMEFEPTPQDYARPKFEPISKEIRHE
IKTETSSKQSKFMQNQQQNQPVFKPKPVAAKFIAATQQQQQKQPQATSRPTMYYNAVAGA
PMHVAKVATETKNVMQMHESTESSQRVVNMQQTKRIIHFDSPQEQRDQQILEPFPYSPAT
SRTPSRQSHLPPPATPTKFVPGEFRESDYESEIDGARIQPLWSPYGDGMTKGFRRVAPPQ
GAGRSCSLPRTYERVLSPMEFDRGPEMPSKIHVDINTLRKEQRGGSTVTTQNRTQSLNRN
TTMRQQQQQQQQQSMDQIDRAGTLPRYGYSSLQQQAENQGRRMGSTFLQKSHQFVDDVSR
EIRSSASNGIRPGFKRAPSEGSSQQPQAFRDESRVSQYGTKCVDPNTGLIYFKYDFGYEF
GILFPGEGHKFVSSQWNSSGSSNSNAKPIQNGRHSPYPLKLPPGNELVIPVQHERSAQGY
SSDNEVQRRSQTRNWSTTKPMAPRTINSHKRYSLPSGHSLDIHLDRLHAQAPRLPPDQMI
RTVPELPNTEPVNAHLSRDELAQRQPLFITPLKDIAVGVGGTARFECIVQAHPQPQVNWT
HNGGLLESGSRHCIEYRNGVCRLTLPQAYPDDNGSYACTAINPLGAATTSGNLTVSSTNR
GFRY
Download sequence
Identical sequences M9PBJ1
FBpp0304429 NP_001261317.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]