SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304474 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304474
Domain Number 1 Region: 267-368
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-26
Family Zf-UBP 0.0061
Further Details:      
 
Domain Number 2 Region: 227-295
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000103
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 380-518
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000015
Family Tropomyosin 0.003
Further Details:      
 
Weak hits

Sequence:  FBpp0304474
Domain Number - Region: 145-217
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000244
Family Canonical RBD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304474   Gene: FBgn0038686   Transcript: FBtr0332165
Sequence length 558
Comment pep:known chromosome:BDGP5:3R:15003807:15006260:-1 gene:FBgn0038686 transcript:FBtr0332165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLNPENISLCVIKIETDLDPSADSEGAVSAEHPTNPRVLKERERDRGLRQSRDITIETY
TNQRWKRELSEPRQQEMNWVAAVQHVNSPSAGSSREITPRSGDDGQAGASASNFPQEIGY
FSGNPIVEVTKGLIHLYKKNERKAIKEAPSNQLCLLAVPATLNCHDLLNFIAPCHAEIKH
IQIVRDGSPNQFMVLLEFRSNESALEFYKSYNGSTYNSLEPDSLCHAVWVSEVERSEHGA
PPMGHTELPTCPVCLERMDESVDGVLTILCNHAFHASCLMKWGDSTCPVCRHVQTPGLVE
DSVCMECEGTDSLWICLICGHVGCGRYQGGHAAAHFRATNHTFAMQLGTSSVWDYAGDNF
VHRLFQNKSDGKLVASQTEKDEREEKIDSMQMEFTYLLTSQLDTQRKYYEERMERLEQEW
QNHKATANDAKTEVSELQQLQQNMQKEKVNLERKLAQHTAKLKDVQKQLNEERELSKALQ
SNQSSWHGKYKLLEQQYNEFKQTHDAEVTELKEQLRDIMFFLDNQQKLANTEIAGGTVTG
IAEKEPDPNTRRRNRRKK
Download sequence
Identical sequences A0A0B4KHR2
NP_001262724.1.81976 FBpp0304474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]