SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304620 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304620
Domain Number 1 Region: 264-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000143
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 2 Region: 181-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000439
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 623-760
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000487
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 4 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000161
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 2389-2433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000021
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 6 Region: 492-625
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000518
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 2221-2259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000567
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 454-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000762
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 14646-14810
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000119
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 408-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000315
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 13896-13919
Classification Level Classification E-value
Superfamily DPY module 0.00000484
Family DPY module 0.00058
Further Details:      
 
Domain Number 12 Region: 20143-20166
Classification Level Classification E-value
Superfamily DPY module 0.00000536
Family DPY module 0.00085
Further Details:      
 
Domain Number 13 Region: 1429-1467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000649
Family EGF-type module 0.028
Further Details:      
 
Domain Number 14 Region: 10058-10081
Classification Level Classification E-value
Superfamily DPY module 0.00000837
Family DPY module 0.001
Further Details:      
 
Domain Number 15 Region: 16980-17003
Classification Level Classification E-value
Superfamily DPY module 0.00000929
Family DPY module 0.00093
Further Details:      
 
Domain Number 16 Region: 13790-13813
Classification Level Classification E-value
Superfamily DPY module 0.00000942
Family DPY module 0.00098
Further Details:      
 
Domain Number 17 Region: 19381-19404
Classification Level Classification E-value
Superfamily DPY module 0.00000981
Family DPY module 0.00087
Further Details:      
 
Domain Number 18 Region: 10394-10547
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000122
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 19 Region: 13477-13500
Classification Level Classification E-value
Superfamily DPY module 0.0000122
Family DPY module 0.001
Further Details:      
 
Domain Number 20 Region: 826-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000149
Family EGF-type module 0.012
Further Details:      
 
Domain Number 21 Region: 15064-15087
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.00091
Further Details:      
 
Domain Number 22 Region: 18387-18410
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.00095
Further Details:      
 
Domain Number 23 Region: 15492-15515
Classification Level Classification E-value
Superfamily DPY module 0.0000183
Family DPY module 0.0012
Further Details:      
 
Domain Number 24 Region: 19938-20098
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 25 Region: 15809-15832
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.00087
Further Details:      
 
Domain Number 26 Region: 11131-11154
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.0011
Further Details:      
 
Domain Number 27 Region: 14535-14558
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.00091
Further Details:      
 
Domain Number 28 Region: 17085-17108
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.00093
Further Details:      
 
Domain Number 29 Region: 15169-15192
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.00083
Further Details:      
 
Domain Number 30 Region: 14429-14452
Classification Level Classification E-value
Superfamily DPY module 0.0000235
Family DPY module 0.001
Further Details:      
 
Domain Number 31 Region: 18265-18288
Classification Level Classification E-value
Superfamily DPY module 0.0000248
Family DPY module 0.0011
Further Details:      
 
Domain Number 32 Region: 9735-9758
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.00089
Further Details:      
 
Domain Number 33 Region: 16340-16363
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.0014
Further Details:      
 
Domain Number 34 Region: 9628-9651
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.001
Further Details:      
 
Domain Number 35 Region: 13582-13605
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.0013
Further Details:      
 
Domain Number 36 Region: 10596-10619
Classification Level Classification E-value
Superfamily DPY module 0.0000327
Family DPY module 0.0012
Further Details:      
 
Domain Number 37 Region: 10703-10726
Classification Level Classification E-value
Superfamily DPY module 0.0000353
Family DPY module 0.0013
Further Details:      
 
Domain Number 38 Region: 16129-16152
Classification Level Classification E-value
Superfamily DPY module 0.0000353
Family DPY module 0.0011
Further Details:      
 
Domain Number 39 Region: 14112-14135
Classification Level Classification E-value
Superfamily DPY module 0.0000366
Family DPY module 0.00093
Further Details:      
 
Domain Number 40 Region: 17944-17967
Classification Level Classification E-value
Superfamily DPY module 0.0000379
Family DPY module 0.0011
Further Details:      
 
Domain Number 41 Region: 18051-18074
Classification Level Classification E-value
Superfamily DPY module 0.0000379
Family DPY module 0.0019
Further Details:      
 
Domain Number 42 Region: 17726-17749
Classification Level Classification E-value
Superfamily DPY module 0.0000392
Family DPY module 0.0011
Further Details:      
 
Domain Number 43 Region: 12730-12753
Classification Level Classification E-value
Superfamily DPY module 0.0000405
Family DPY module 0.0013
Further Details:      
 
Domain Number 44 Region: 13366-13389
Classification Level Classification E-value
Superfamily DPY module 0.0000405
Family DPY module 0.0015
Further Details:      
 
Domain Number 45 Region: 19823-19846
Classification Level Classification E-value
Superfamily DPY module 0.0000445
Family DPY module 0.001
Further Details:      
 
Domain Number 46 Region: 13154-13177
Classification Level Classification E-value
Superfamily DPY module 0.0000484
Family DPY module 0.0014
Further Details:      
 
Domain Number 47 Region: 9312-9335
Classification Level Classification E-value
Superfamily DPY module 0.0000497
Family DPY module 0.0013
Further Details:      
 
Domain Number 48 Region: 8992-9015
Classification Level Classification E-value
Superfamily DPY module 0.0000575
Family DPY module 0.0015
Further Details:      
 
Domain Number 49 Region: 9523-9546
Classification Level Classification E-value
Superfamily DPY module 0.0000575
Family DPY module 0.0017
Further Details:      
 
Domain Number 50 Region: 17620-17643
Classification Level Classification E-value
Superfamily DPY module 0.0000602
Family DPY module 0.0016
Further Details:      
 
Domain Number 51 Region: 18492-18515
Classification Level Classification E-value
Superfamily DPY module 0.0000602
Family DPY module 0.0018
Further Details:      
 
Domain Number 52 Region: 19488-19511
Classification Level Classification E-value
Superfamily DPY module 0.0000615
Family DPY module 0.0014
Further Details:      
 
Domain Number 53 Region: 20468-20491
Classification Level Classification E-value
Superfamily DPY module 0.0000667
Family DPY module 0.0011
Further Details:      
 
Domain Number 54 Region: 11561-11584
Classification Level Classification E-value
Superfamily DPY module 0.0000706
Family DPY module 0.0012
Further Details:      
 
Domain Number 55 Region: 14323-14346
Classification Level Classification E-value
Superfamily DPY module 0.0000706
Family DPY module 0.0014
Further Details:      
 
Domain Number 56 Region: 11983-12006
Classification Level Classification E-value
Superfamily DPY module 0.0000719
Family DPY module 0.0013
Further Details:      
 
Domain Number 57 Region: 910-951
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000734
Family EGF-type module 0.021
Further Details:      
 
Domain Number 58 Region: 1017-1064
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000077
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 59 Region: 16447-16470
Classification Level Classification E-value
Superfamily DPY module 0.0000824
Family DPY module 0.001
Further Details:      
 
Domain Number 60 Region: 2746-2790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000891
Family EGF-type module 0.025
Further Details:      
 
Domain Number 61 Region: 16553-16576
Classification Level Classification E-value
Superfamily DPY module 0.0000968
Family DPY module 0.0015
Further Details:      
 
Weak hits

Sequence:  FBpp0304620
Domain Number - Region: 9420-9443
Classification Level Classification E-value
Superfamily DPY module 0.000106
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 12839-12862
Classification Level Classification E-value
Superfamily DPY module 0.000112
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 12944-12967
Classification Level Classification E-value
Superfamily DPY module 0.000114
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 16767-16790
Classification Level Classification E-value
Superfamily DPY module 0.000114
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 9842-9865
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 1141-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 12408-12431
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 15275-15298
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 15914-15937
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 17209-17363
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000155
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number - Region: 12200-12223
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 14956-14979
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 17512-17535
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 10278-10301
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 11665-11688
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 11770-11793
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 20666-20688
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 9098-9120
Classification Level Classification E-value
Superfamily DPY module 0.000196
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 1334-1479
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000204
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 10811-10834
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 15387-15410
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 9204-9227
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 17407-17430
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 14003-14026
Classification Level Classification E-value
Superfamily DPY module 0.000235
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 13260-13283
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 14219-14242
Classification Level Classification E-value
Superfamily DPY module 0.000275
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 20574-20596
Classification Level Classification E-value
Superfamily DPY module 0.000314
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 12621-12644
Classification Level Classification E-value
Superfamily DPY module 0.000327
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 11880-11903
Classification Level Classification E-value
Superfamily DPY module 0.00034
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 12306-12329
Classification Level Classification E-value
Superfamily DPY module 0.00034
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 13685-13708
Classification Level Classification E-value
Superfamily DPY module 0.000379
Family DPY module 0.0011
Further Details:      
 
Domain Number - Region: 20357-20380
Classification Level Classification E-value
Superfamily DPY module 0.000379
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 9952-9975
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 16873-16896
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 17192-17215
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0026
Further Details:      
 
Domain Number - Region: 10919-10942
Classification Level Classification E-value
Superfamily DPY module 0.000432
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 17474-17507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 18120-18213
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000534
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number - Region: 13046-13069
Classification Level Classification E-value
Superfamily DPY module 0.000602
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 12514-12537
Classification Level Classification E-value
Superfamily DPY module 0.000745
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 10168-10191
Classification Level Classification E-value
Superfamily DPY module 0.000837
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 16662-16685
Classification Level Classification E-value
Superfamily DPY module 0.000837
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 2342-2501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00104
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 15501-15652
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0011
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number - Region: 19618-19773
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0011
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number - Region: 17833-17856
Classification Level Classification E-value
Superfamily DPY module 0.00119
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 11451-11474
Classification Level Classification E-value
Superfamily DPY module 0.00131
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 10881-10914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00168
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 12089-12112
Classification Level Classification E-value
Superfamily DPY module 0.0017
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 11041-11190
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00173
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 14853-14876
Classification Level Classification E-value
Superfamily DPY module 0.00183
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 15987-16084
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00188
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 15072-15228
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00204
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 21113-21136
Classification Level Classification E-value
Superfamily DPY module 0.00209
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 2632-2795
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0022
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 21243-21266
Classification Level Classification E-value
Superfamily DPY module 0.00235
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 9589-9623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00262
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 984-1028
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00266
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 16836-16868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00288
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 17686-17720
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00292
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 14599-14633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00298
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 17582-17615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00298
Family Merozoite surface protein 1 (MSP-1) 0.061
Further Details:      
 
Domain Number - Region: 8884-8907
Classification Level Classification E-value
Superfamily DPY module 0.00301
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 20732-20755
Classification Level Classification E-value
Superfamily DPY module 0.00353
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 11843-11875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00379
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 17790-17827
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00498
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 16514-16548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00514
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 19571-19604
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00568
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 14331-14486
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00573
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 15702-15725
Classification Level Classification E-value
Superfamily DPY module 0.00628
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 9380-9413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00656
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 20854-20877
Classification Level Classification E-value
Superfamily DPY module 0.00772
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 9487-9518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00812
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 20265-20416
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00832
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 10718-10870
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0102
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 8564-8600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0128
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 11652-11829
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.013
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 11235-11258
Classification Level Classification E-value
Superfamily DPY module 0.0144
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 20212-20245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0147
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 21889-21911
Classification Level Classification E-value
Superfamily DPY module 0.0157
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 17155-17187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0168
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 10078-10227
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0173
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number - Region: 8783-8804
Classification Level Classification E-value
Superfamily DPY module 0.0183
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 16942-16975
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0197
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 9850-10010
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0204
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 19892-19925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0206
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 20250-20273
Classification Level Classification E-value
Superfamily DPY module 0.0222
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 11304-11337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0238
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 19342-19376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0242
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 16242-16399
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0267
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 790-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0271
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 15352-15448
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0282
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number - Region: 16562-16720
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0283
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number - Region: 20535-20567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0288
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 18349-18381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0324
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 12804-12901
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0361
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 13269-13429
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0361
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 8845-8878
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0393
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 14496-14529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0405
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 19787-19817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 12694-12792
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0439
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 11526-11556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0492
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 9804-9837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0509
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 13441-13536
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0518
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 13648-13680
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0549
Family EGF-like domain of nidogen-1 0.051
Further Details:      
 
Domain Number - Region: 12370-12403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.055
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 21054-21075
Classification Level Classification E-value
Superfamily DPY module 0.0562
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 11945-11977
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0569
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 22142-22164
Classification Level Classification E-value
Superfamily DPY module 0.0615
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 10020-10052
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0636
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 22080-22100
Classification Level Classification E-value
Superfamily DPY module 0.0654
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 15026-15059
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0689
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 20428-20456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0704
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 876-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0711
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 18454-18487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.074
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 18226-18260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.077
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 8414-8573
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0785
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number - Region: 11366-11509
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.08
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 21963-21983
Classification Level Classification E-value
Superfamily DPY module 0.0824
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 15876-15909
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 1827-1946
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0895
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 9107-9263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0895
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 13223-13254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0943
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 10988-11021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0954
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 13009-13041
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0988
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304620   Gene: FBgn0053196   Transcript: FBtr0332343
Sequence length 22743
Comment pep:known chromosome:BDGP5:2L:4479471:4595054:-1 gene:FBgn0053196 transcript:FBtr0332343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNE
STEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGY
GGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAAR
CVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP
DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD
ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGS
FQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQP
DGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFV
CTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACE
QVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNT
PGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAA
GCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKC
GAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPE
PNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAE
KAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCI
CRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEI
CNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSC
VDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAAN
EKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLL
GCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC
ASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGD
GALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVC
GIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPG
TFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK
PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQ
KGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICF
QLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEE
DKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNP
VVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCD
CLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAV
CVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEES
CGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKC
PPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVC
SCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNV
CVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCS
IDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAV
GERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIG
TPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCA
NNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHV
DCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQ
PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCE
RQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPC
SLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSP
LCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLS
DAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSN
DKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCG
PGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVC
AQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSV
CKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKE
CVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVC
LHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNP
TPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN
ECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCL
CPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRT
VCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVN
HGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKC
RNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTV
SEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCR
VVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAH
QGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRT
LGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTV
LHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCT
DPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMAC
SDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACR
KLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQ
AHQCGSSGKCIDPCLTSCAGGVKCVVSAHRVTICTCPATLTNNTDSNCTSTDITVGTTTQ
RIETTTDFINVKYTVMQLANQTEMRTRFTDIEAENETTGPYTTTTESYKTTKQLSSNPET
ETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSESTTREVYT
IKPFDRSTPTPVSPDTTVPSITFETTTNIPIGTTRGQVTEQTTSSPSEKRTTIRVEESTL
PSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNDPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTTPSESPETPT
TLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGG
QVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTES
TRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTSSPSEVRTTIR
VEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSA
SLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSE
SPETPTTLPSDFTIRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVP
IGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYS
DQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSE
VRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEA
STPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSAD
RTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLE
TTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDF
TTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQT
TSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRTYSDQTTESTRDVPT
TRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTL
PSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPT
LPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVPIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTECT
RDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRV
EESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSASL
ETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESP
ETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGS
TGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQT
TESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRT
TIGVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTP
SPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTS
PSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTT
NVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITR
PHSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSES
PETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQ
TTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVR
TTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTRDVPTTRPFEAST
PSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRT
TPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETT
TSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFIT
RPHSEKTTESTRDVPTTRPFEASTPSSASSGNNCSISYFRNHYKCSNRFNRSADRTTPSE
SPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPI
GSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEV
RTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEAS
TPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDR
TSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSET
TTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFI
TRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTT
SSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTT
QPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLP
SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLETAVP
PVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTT
LPSDFTTRPHSDQTTESTRDVPTTRPFESSTPRPVTLEIAVPPVTSETTTNVAIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTEST
RDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRV
EESTLPSRSTDRTPPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVT
LEIAVPPVTSETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSES
PETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTTNVPIGSTVTSETTTNVPIGSTG
GQVAGQTTAPPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTE
STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPSEVRTTI
RVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFETSTPSP
VSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDTTIPSE
IPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRDA
LETTVTSLITETTKTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERTMPSNISSTTTV
FNNSEPVSDNLPTTISITVTDSPTTVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCT
VQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTF
NNPCSRNEDCRVFNHQPLCSAEHGRTPGCEHCPPGANCDPTTGACIKEPPGSPKTPEPCQ
SNNDCIESEACYMGLCQDPCEFAKICAATAKCTAKSHRPVCTCPQGHEGNPMVKCVTTQT
SIECTDDSDCGVTEACINQLCQHPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVGC
QPARSHVCQYNEDCPPTKLCDRLNRRCINPCQEDSCGENAECIPVNHGTECRCLPGFLGN
AYVQCLPSQGCRSDSECDSSQACINGKCSSPCQCGAYALCDVVNHRGVCKCPPGYNGNPK
VGCSPPQDPCDPNPCGLNALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCGPNS
GCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNY
VESPNTIRGCVEPINPCDPNPCGTGAICDSSRHPVCYCPDNKIGNPFRLCDKPAVTIELC
QPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQ
TACVCPDGLSGDPTSVIGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEH
HPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQ
SGCQPECDINSDCGDTLSCINHKCVDPCAGAICGINAICNVRQHTPVCLCLDGFVGDAFL
QCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPECVGNSD
CPFDRACLGQRCLDPCPGSCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPPQ
PSCAKLHCGANAECKRQHSGLACVCRKGYFGDPHIGCRPECVLNSDCPAEKACLNSKCVE
ACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRC
KATPDGYAACSCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCPGICGGGARCEV
LNHNPICSCEANFEGDPFVACSPIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSC
VANYIGSPPYCRPECTLSSECPSDKACINEKCQNPCANVCGHNARCTVIAHSAHCSCDED
YEGDAFIGCSKKITERPGDHIDPCYPNPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCR
PECIYSSECPSSLACIKQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPFDGCKRV
VVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCIN
QKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCG
SNSICRNVNNRAECSCAPGMFGAPPNCRPECVINQDCPSNRACIRQRCEDPCIGICGFNA
VCSTQNHQPKCSCIESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGSC
SCIQNYFGDPYINCRPECVQNSDCPNNRACINMKCRDPCANACGFNAICRVAHHQPVCSC
EPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPPN
CKPECMTSAECPSDRACINQRCKDPCPGTCGYNARCRCTNHSPICSCYDGYTGDPFHQCV
PERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPECSINSE
CPARMACINARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVI
QPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCVD
PCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCG
LYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGTCGNNA
LCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANE
QAVCSCLQHYVGRAPNCRPECTSDSECPGNLACINLRCRDPCVGTCGIQTTCLVNNHRPI
CRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPY
TECRPECVLNSDCSKNRACLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQF
CREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQD
RACVNQRCADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNEN
PCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNCRPECTINTECPANLACINERCQDPC
PGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECR
ERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSRDKSCVNQKCVDPCPGVCGLNAQCRVS
NHLPSCSCLAGYTGNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCL
QGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDPCPGTCGIEARCQVINHYPACSCAPGF
TGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRP
ECLSSADCPANLACVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQ
QIAPPDETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDRSR
ACINNKCQDPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPS
PCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGSCG
NNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAA
CSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSC
ADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYD
AQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPF
FSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAEC
APEKACVHKKCVDPCQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTP
SPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFIGAPPRCRPECVLNSECGPTEACINQK
CADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCG
QNADCFAGECRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCPGICGNNAVCE
VMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLE
GYIGAPPQCRPECVVSSECSALQACVNKKCVDPCAAACGLEARCEVINHSPICGCPPGRT
GDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCR
PECIINPDCQSTQACINNKCSNPCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQ
QEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIR
NKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPC
GANSKCRVANGLAVCSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCAKTCGLN
AKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVR
DEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHL
AICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQGD
PYTGCRPECTLSTDCAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPF
VHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLH
TACVNRKCVDPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPC
QPSPCGPNSECKVLNGNAACSCAATFIGTPPSCRPECSINPECPPTKACIRQKCSDPCVN
ACGFNARCNVANHQPICTCDVGYTGDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRER
NGIGSCQCLPDHFGDPYQSCRPECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNH
LPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLE
LYIGLPPNCRPECVLSTECPTDKACISQRCQDPCPGTCGINAECRVRNHSPLCQCRQGFT
GDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRP
ECTISAECPSNLACIRERCIDPCPGSCGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAP
PPEPTQSEYVDPCNPSPCGPNAQCNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDKACH
SSKCVNPCPGTCGENAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPCRPSPCGPN
SQCREVNQQAVCSCLPSFIGAPPSCRPECTSNSECAPTQACLNQRCGDPCPGTCGVGANC
AVVSHSPFCTCPERFTGNPFIRCQPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPAC
SCVETYIGRPPNCRPECVTSSDCSSQLACVNQKCVDPCPGRCGLNAECFVVSHAVQCICQ
QGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCR
PECMLDSDCPSNRACQQLRCQDPCPGTCGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRL
PEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRA
CVNQKCVDPCAADTCGNNAICRVRNHSPICSCISGYTGDAFTRCFLIPPPIIETKDEPLR
DPCIPTPCGPNSECRNINGVPACSCLVNFIGQAPNCRPECTINSECPSQLACINQKCRDP
CPGACGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANA
QCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPCSGTCGVNALCEVNN
HIPICRCPEQMSGNAFFECRPVPPAKIQNPCQPSPCGPNSQCRVVQQTAVCSCLANYVGS
PPQCRPECVTNSDCPADQDCQNMKCRDPCPGTCGFNALCNVVNHRPFCSCPTGMSGNPFV
SCQQLIIRDERPQNPCQPSPCGPNSECRVSGDSPSCSCLPEFVGAPPNCRPECISNSECP
TNQACINQKCVDPCPGLCGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPIRDSPPEVLQP
CNPSPCGVNAKCEERGGAGSCQCLPDYFGNPYDGCRPECVLNSDCPSNQACVNQKCRDPC
PGTCGQNAECQVVNHLATCNCLVGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQC
REVNEQGVCSCLPEFIGSPPACRPECTSSSECAADKACVNRKCVDPCPNVCGQQAECRVR
NHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCSC
LPQYLGTPPNCRPECSINAECPSHQACINQKCRDPCPGSCGLNTQCSVINHTPICSCLAG
YIGDPFSVCNPEPIPEKIRDPLPPEDPCNPSPCGSNTQCNNGVCSCLPEYHGDPYTGCRP
ECVLHTDCDRSRACVRHKCVDPCPGTCGTNAICEVLNHIPNCRCLEGMQGNAFIQCSPVP
KLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITSFIGSPPFCRPECTTNSECPLNLACRN
QKCSDPCPGVCGRGAQCHVTNHSPFCRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPC
GPYSQCREVNESPSCTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPGLCGQS
AECRVLSHTPSCVCPEGMEGDPFTLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGSC
QCLPDYFGNPYEGCRPECVLNSDCPSNKACQQQKCQDPCPGTCGQNALCNVLNHIPSCSC
ISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPE
CTISSECPADKACVNQKCVDPCPNTCGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKPP
VPPTPVQKTPVDPCVPTPCGPYSQCRSQGDAPACSCLVGYIGAPPNCRPECRINAECPSS
QACINEKCRDPCPGSCGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDD
PCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGT
CAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQA
VCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCT
CLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSP
PYCKPECVANSECPSNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQ
CQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPS
NRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPIVHEYVNP
CQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNCRPQCTSSSECASNRACINQKCVDPCP
GVCGQQAICEVRNHSPICRCPTAMIGDPFVRCIPRPTIAPPPLRDVAPYRDPCLPSPCGL
YASCRNQQNQAVCSCLPNYFGTPPHCRPECSINAECPSHLACIGERCRDPCPGACGQQTE
CRVISHVPSCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSNQGECKCV
ADYQGDPYVACRPECVLSSECPRNLACIQQKCTDPCPGTCGTNAICDVVNHIAMCHCPDR
MTGNAFVQCTPVQLDVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECST
NYDCSPSLACQNQRCVDPCPGACGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQR
DITPKDPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRPECVSNSECSQVHVCSNN
RCKDPCPGLCGTDAVCRVISHSAMCYCQPGYSGDPFVRCAPHIQRESIEIVQPCNPNPCG
AFAECRQQNGVGSCQCLPEYFGNPYEGCRPECVLDSDCPSQLACVNQKCRDPCPGSCGQN
AECFVRNHLPTCNCLSGYVGDPYRYCSIEPKPIREYVNPCQPSPCGPNSQCREQNGVATC
SCLPEFVGTPPGCRPECTVSSECNLDKACVRHKCLDPCPGACGSSANCQVVNHAPLCSCQ
AGYTGDPFTRCYPIPSPPTHIVHDYARHPCQPSPCGANAQCRQSQGQAICSCIPNYFGVP
PNCRPECTQSSECLSSLACINQRCADPCPGSCAYNAICHVRNHVPSCQCPVGYVGDPFTN
CHPEPQPPPKPVALDDPCNPSPCGANAVCQNGQCSCIPEYQGDPYTGCRPECVLNADCPR
NRACVRHKCVDPCPGTCAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPCY
PSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQRQHCIDPCPGT
CGFNALCHVVNHAPICSCPPKHNGNPFLGCFPEPVRRDEVIPKNPCQPSPCGPYAKCTSV
GDQAQCSCLPEYIGTPPNCRPECITNSECSFDKACLNQRCRDPCSGTCGSNANCHVISHT
AMCYCLPGFTGDPFTSCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYG
NPYETCRPECVTNNDCPSNKACQQQKCRDPCPGVCALNALCRVINHLPTCHCQNGFVGDP
YRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSA
ECPHDKACIRQKCNDPCPGVCGSNADCRVIQHAPICSCRAGFTGDAFSRCLPLPPSRPPQ
LDVYRNPCVPSPCGQYAECRDNQGTATCSCLPSYFGTPPNCRPECTINPDCPSHLSCQQQ
RCRDPCPGACGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLIT
CGPNAVCNQGQCNCLPEFVGNPLVGCRPECVLSTECDWSKACVRNKCIDPCPGTCGSNAI
CEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRDVIDPCQPSPCGPNAQCRNINGQAVCS
CLRDFIGVPPSCRPECVSNAECPLHLACLQRHCRDPCPGVCGLNAECRVINHSPNCHCIG
SFTGNPFAACHRPPPPPIKHEPIDPCQPSPCGANAECRVQGSNAQCSCLSGFIGTPPNCR
PECVSNSDCPMNLACLNQKCRDPCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVV
RDVPEPQTPCVPSPCGANALCSEGNGAGACKCLPEFYGNPYEGCRPECVLNSDCPSHLAC
LNQHCRDPCPGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQP
SPCGPNSQCRESNNQAICKCLPNFIGSPPACRPECTISSECDLTLACVQQHCVDPCPGVC
GNSAQCRVINHSPHCSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVPSPCGAFGQC
RAQGNQAICSCLPGYYGAPPNCRPECAINPDCASHLACISEKCRDPCPGSCGLQAQCSVI
NHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQCSCLPDFDG
NPYVGCRPECVLNTDCARDKACQRSKCTDPCPGACGIGAVCEVRNHIPTCNCPPGTSGNA
FVQCTLVQSSPVVPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINSD
CAPHLACLNQQCRDPCPGACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQR
EPINPCYPSPCGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLACIGQKC
KDPCSGLCGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPIQREQINPCYQNPCGSNA
VCRERGEAASCQCLPEYYGNPYEGCRPECVLNSDCSSHLACLNQHCRDPCPGSCAPNAQC
QVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQPSPCGPNSQCTESQGQAVCR
CLPDYYGSPPACRPECTTNPECPNDKACVSRRCTDPCAGACGQNAICRAHQHRAYCSCHP
GYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTP
PYCRPECTQNSDCPSHRACVNQRCVDPCPGACGLNARCDVLNHVPSCSCPEGYLGDPFYR
CYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNGVCSCLPLYQGDPYVGCRPECVLSTEC
PWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVELH
PCQPSPCGHHGECREVGSQAICTCRLGYYGSPPACRPECVSDPECPPSLACVNQKCRDPC
PGACGHLAQCHVINHSPQCVCPAGYTGSPYSECHLIRADSSPIQRQPIDPCLPSPCGPHA
QCSNEGGNAVCRCLTEYLGVPPYCRPECIANSECPSDRACINRKCQDPCPGLCGYNAICR
TYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATPPTTAIQVLQYEEPFINGCEPNPCGAN
AQCNQRRGVVSCVCLPDYFGNPYEACRPECILNSDCPLSRACVQQKCRDPCPGTCGLNAE
CHVMDHLPQCRCFSGYTGNPLAYCSPVPIIQESPLTPCDPSPCGPNAQCHPSLNEAVCSC
LPEFYGTPPNCRPECTLNSECAYDKACVHHKCVDPCPGICGINADCRVHYHSPICYCISS
HTGDPFTRCYETPKPVRPQIYDTPSPPYPVAIPDLVYVQQQQPGIVNIPSAPQPIYPTPQ
SPQYNVNYPSPQPANPQKPGVVNIPSVPQPVYPSPQPPVYDVNYPTTPVSQHPGVVNIPS
APRLVPPTSQRPVFITSPGNLSPTPQPGVINIPSVSQPGYPTPQSPIYDANYPTTQSPIP
QQPGVVNIPSVPSPSYPAPNPPVNYPTQPSPQIPVQPGVINIPSAPLPTTPPQHPPVFIP
SPESPSPAPKPGVINIPSVTHPEYPTSQVPVYDVNYSTTPSPIPQKPGVVNIPSAPQPVH
PAPNPPVHEFNYPTPPAVPQQPGVLNIPSYPTPVAPTPQSPIYIPSQEQPKPTTRPSVIN
VPSVPQPAYPTPQAPVYDVNYPTSPSVIPHQPGVVNIPSVPLPAPPVKQRPVFVPSPVHP
TPAPQPGVVNIPSVAQPVHPTYQPPVVERPAIYDVYYPPPPSRPGVINIPSPPRPVYPVP
QQPIYVPAPVLHIPAPRPVIHNIPSVPQPTYPHRNPPIQDVTYPAPQPSPPVPGIVNIPS
LPQPVSTPTSGVINIPSQASPPISVPTPGIVNIPSIPQPTPQRPSPGIINVPSVPQPIPT
APSPGIINIPSVPQPLPSPTPGVINIPQQPTPPPLVQQPGIINIPSVQQPSTPTTQHPIQ
DVQYETQRPQPTPGVINIPSVSQPTYPTQKPSYQDTSYPTVQPKPPVSGIINIPSVPQPV
PSLTPGVINLPSEPSYSAPIPKPGIINVPSIPEPIPSIPQNPVQEVYHDTQKPQAIPGVV
NVPSAPQPTPGRPYYDVAKPDFEFNPCYPSPCGPYSHCHNRFGVAACVCLPNYRGTPPNC
RPECVINSDCPSSLACINEKCRDPCPGSCAYNAVCRVHEHVPNCYCQTGYTGNPFISCQR
TPIAPVQREPIEAKDPCYPSICGPNAVCNNGKCSCIPEYRGDPYVGCRPECVLNTDCARD
KACIQQKCKNPCPGTCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPT
TLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTPPGCRPECTSNSDCPL
DKYCLNLRCRDPCPGACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVN
PCQPSPCGPNSECQATSGGARCSCLPQYHGTPPFCRPECVNSADCPADKACRNYKCIDPC
PGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQ
PHNDLSVCQCLPGYYGNPSEICRPECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVI
NHSPVCECHTGHVGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLP
EFVGTPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFT
GDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRP
ECTINAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLP
PPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVN
QKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSP
CGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGL
NAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQ
AECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCPGSCGQSAQCTVSLHIPNC
QCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYI
GNPYEGCRPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGN
AFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLS
SDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPI
DPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICR
AINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSN
ICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFT
QCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNC
GIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPC
DVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEA
CRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSE
CQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINA
DCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQY
NEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVK
TPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVT
DISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCN
CPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAYC
HVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPN
AECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCAL
NAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCA
QNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCS
VLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEA
CIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACIN
GDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQ
NEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGR
QACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEV
GGCISDSDCPTDKSCLNSVCRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIEC
SINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGC
RSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERH
IPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNP
AVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALE
RGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLT
KVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTNFRTDFPRPDMVVSCLADGVQVEIH
ITEPGFNGVLYVKGHSKDEECRRVVNLAGETVPRTEIFRVHFGSCGMQAVKDVASFVLVI
QKHPKLVTYKAQAYNIKCVYQTGEKNVTLGFNVSMLTTAGTIANTGPPPICQMRIITNEG
EEINSAEIGDNLKLQVDVEPATIYGGFARSCIAKTMEDNVQNEYLVTDENGCATDTSIFG
NWEYNPDTNSLLASFNAFKFPSSDNIRFQCNIRVCFGRCQPVNCGGYNAFGRRRRSIADN
STDATAIATNSGVEGQLREEITISSNAILTFEKRSGQGLNDANIKPAAQRVEDICVSMVG
LIIALVITALLALVAVAVAVSCWLMAYRRRPKTIAPLPHPPEFPNPLFSNPDAVPEPTPD
YIS
Download sequence
Identical sequences M9PC41
NP_001260030.1.81976 FBpp0304620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]