SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304621 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304621
Domain Number 1 Region: 264-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000013
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 2 Region: 181-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000392
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 623-760
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000424
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 4 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000147
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 2389-2433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000185
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 6 Region: 492-625
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000439
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 2221-2259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000527
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 454-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000753
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 408-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000271
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 18110-18133
Classification Level Classification E-value
Superfamily DPY module 0.00000484
Family DPY module 0.00085
Further Details:      
 
Domain Number 11 Region: 1429-1467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000534
Family EGF-type module 0.028
Further Details:      
 
Domain Number 12 Region: 10264-10287
Classification Level Classification E-value
Superfamily DPY module 0.00000759
Family DPY module 0.001
Further Details:      
 
Domain Number 13 Region: 14947-14970
Classification Level Classification E-value
Superfamily DPY module 0.00000837
Family DPY module 0.00093
Further Details:      
 
Domain Number 14 Region: 10599-10753
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000847
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 15 Region: 17348-17371
Classification Level Classification E-value
Superfamily DPY module 0.00000889
Family DPY module 0.00087
Further Details:      
 
Domain Number 16 Region: 958-1070
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000124
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 17 Region: 13031-13054
Classification Level Classification E-value
Superfamily DPY module 0.0000144
Family DPY module 0.00091
Further Details:      
 
Domain Number 18 Region: 16354-16377
Classification Level Classification E-value
Superfamily DPY module 0.0000144
Family DPY module 0.00095
Further Details:      
 
Domain Number 19 Region: 826-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000149
Family EGF-type module 0.012
Further Details:      
 
Domain Number 20 Region: 13459-13482
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.0012
Further Details:      
 
Domain Number 21 Region: 13776-13799
Classification Level Classification E-value
Superfamily DPY module 0.0000183
Family DPY module 0.00087
Further Details:      
 
Domain Number 22 Region: 15052-15075
Classification Level Classification E-value
Superfamily DPY module 0.0000183
Family DPY module 0.00093
Further Details:      
 
Domain Number 23 Region: 11337-11360
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.0011
Further Details:      
 
Domain Number 24 Region: 13136-13159
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.00083
Further Details:      
 
Domain Number 25 Region: 17905-18065
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000022
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 26 Region: 9941-9964
Classification Level Classification E-value
Superfamily DPY module 0.0000262
Family DPY module 0.00089
Further Details:      
 
Domain Number 27 Region: 14307-14330
Classification Level Classification E-value
Superfamily DPY module 0.0000262
Family DPY module 0.0014
Further Details:      
 
Domain Number 28 Region: 9834-9857
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.001
Further Details:      
 
Domain Number 29 Region: 10802-10825
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.0012
Further Details:      
 
Domain Number 30 Region: 10909-10932
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.0013
Further Details:      
 
Domain Number 31 Region: 14096-14119
Classification Level Classification E-value
Superfamily DPY module 0.0000327
Family DPY module 0.0011
Further Details:      
 
Domain Number 32 Region: 844-963
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000033
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 33 Region: 15911-15934
Classification Level Classification E-value
Superfamily DPY module 0.000034
Family DPY module 0.0011
Further Details:      
 
Domain Number 34 Region: 16018-16041
Classification Level Classification E-value
Superfamily DPY module 0.000034
Family DPY module 0.0019
Further Details:      
 
Domain Number 35 Region: 15693-15716
Classification Level Classification E-value
Superfamily DPY module 0.0000353
Family DPY module 0.0011
Further Details:      
 
Domain Number 36 Region: 17790-17813
Classification Level Classification E-value
Superfamily DPY module 0.0000392
Family DPY module 0.001
Further Details:      
 
Domain Number 37 Region: 9518-9541
Classification Level Classification E-value
Superfamily DPY module 0.0000445
Family DPY module 0.0013
Further Details:      
 
Domain Number 38 Region: 9198-9221
Classification Level Classification E-value
Superfamily DPY module 0.0000523
Family DPY module 0.0015
Further Details:      
 
Domain Number 39 Region: 9729-9752
Classification Level Classification E-value
Superfamily DPY module 0.0000523
Family DPY module 0.0017
Further Details:      
 
Domain Number 40 Region: 16459-16482
Classification Level Classification E-value
Superfamily DPY module 0.0000536
Family DPY module 0.0018
Further Details:      
 
Domain Number 41 Region: 15587-15610
Classification Level Classification E-value
Superfamily DPY module 0.0000549
Family DPY module 0.0016
Further Details:      
 
Domain Number 42 Region: 17455-17478
Classification Level Classification E-value
Superfamily DPY module 0.0000549
Family DPY module 0.0014
Further Details:      
 
Domain Number 43 Region: 2746-2790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000567
Family EGF-type module 0.025
Further Details:      
 
Domain Number 44 Region: 1141-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family EGF-type module 0.016
Further Details:      
 
Domain Number 45 Region: 18435-18458
Classification Level Classification E-value
Superfamily DPY module 0.0000602
Family DPY module 0.0011
Further Details:      
 
Domain Number 46 Region: 11767-11790
Classification Level Classification E-value
Superfamily DPY module 0.0000641
Family DPY module 0.0012
Further Details:      
 
Domain Number 47 Region: 12189-12212
Classification Level Classification E-value
Superfamily DPY module 0.0000641
Family DPY module 0.0013
Further Details:      
 
Domain Number 48 Region: 14414-14437
Classification Level Classification E-value
Superfamily DPY module 0.0000745
Family DPY module 0.001
Further Details:      
 
Domain Number 49 Region: 14520-14543
Classification Level Classification E-value
Superfamily DPY module 0.0000863
Family DPY module 0.0015
Further Details:      
 
Domain Number 50 Region: 9626-9649
Classification Level Classification E-value
Superfamily DPY module 0.0000955
Family DPY module 0.0014
Further Details:      
 
Weak hits

Sequence:  FBpp0304621
Domain Number - Region: 14734-14757
Classification Level Classification E-value
Superfamily DPY module 0.000102
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 10048-10071
Classification Level Classification E-value
Superfamily DPY module 0.000118
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 12614-12637
Classification Level Classification E-value
Superfamily DPY module 0.000124
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 13881-13904
Classification Level Classification E-value
Superfamily DPY module 0.000129
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 13242-13265
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 15479-15502
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 12406-12429
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 12923-12946
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 16131-16291
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000152
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number - Region: 10484-10507
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 18633-18655
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 9304-9326
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 1334-1479
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000173
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 11017-11040
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 11233-11256
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 15176-15330
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000188
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number - Region: 13354-13377
Classification Level Classification E-value
Superfamily DPY module 0.000196
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 9410-9433
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 15374-15397
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 13991-14014
Classification Level Classification E-value
Superfamily DPY module 0.000275
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 18541-18563
Classification Level Classification E-value
Superfamily DPY module 0.000275
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 12512-12535
Classification Level Classification E-value
Superfamily DPY module 0.000301
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 12086-12109
Classification Level Classification E-value
Superfamily DPY module 0.000314
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 13467-13619
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00033
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number - Region: 10158-10181
Classification Level Classification E-value
Superfamily DPY module 0.000353
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 14840-14863
Classification Level Classification E-value
Superfamily DPY module 0.000353
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 15159-15182
Classification Level Classification E-value
Superfamily DPY module 0.000353
Family DPY module 0.0026
Further Details:      
 
Domain Number - Region: 11125-11148
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 16084-16118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000469
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 12720-12743
Classification Level Classification E-value
Superfamily DPY module 0.00068
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 11880-12035
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000722
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 10374-10397
Classification Level Classification E-value
Superfamily DPY module 0.000759
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 14629-14652
Classification Level Classification E-value
Superfamily DPY module 0.000759
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 15441-15474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00082
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 17585-17740
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00102
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number - Region: 2342-2501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00108
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 11657-11680
Classification Level Classification E-value
Superfamily DPY module 0.00122
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 11087-11120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00143
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 18234-18383
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00157
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 12295-12318
Classification Level Classification E-value
Superfamily DPY module 0.00157
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 12820-12843
Classification Level Classification E-value
Superfamily DPY module 0.00157
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 19080-19103
Classification Level Classification E-value
Superfamily DPY module 0.00183
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 2632-2795
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 15653-15687
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00204
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 19210-19233
Classification Level Classification E-value
Superfamily DPY module 0.00209
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 11247-11394
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0022
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 9795-9829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00225
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 15549-15582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00254
Family Merozoite surface protein 1 (MSP-1) 0.061
Further Details:      
 
Domain Number - Region: 9090-9113
Classification Level Classification E-value
Superfamily DPY module 0.00275
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 14200-14223
Classification Level Classification E-value
Superfamily DPY module 0.00327
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 18699-18722
Classification Level Classification E-value
Superfamily DPY module 0.00327
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 15707-15862
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0033
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 12049-12081
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0033
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 13039-13195
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00424
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 17538-17571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00483
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 14803-14835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00559
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 17859-17892
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00617
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 9586-9619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00639
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 9693-9724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00691
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 18821-18844
Classification Level Classification E-value
Superfamily DPY module 0.00693
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 15122-15154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00788
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 10056-10216
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00863
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 13955-14051
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00895
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 8770-8806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 13573-13728
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.011
Family Growth factor receptor domain 0.0074
Further Details:      
 
Domain Number - Region: 18179-18212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 11441-11464
Classification Level Classification E-value
Superfamily DPY module 0.0127
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 19856-19878
Classification Level Classification E-value
Superfamily DPY module 0.0144
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 10925-11076
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0157
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 8989-9010
Classification Level Classification E-value
Superfamily DPY module 0.0157
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 14909-14942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0168
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 11404-11436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.017
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 18217-18240
Classification Level Classification E-value
Superfamily DPY module 0.0196
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 11510-11543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0202
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 790-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0207
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 17309-17343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0223
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 13319-13415
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0235
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number - Region: 16316-16348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0278
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 18502-18534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0316
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 17754-17784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0367
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 9051-9084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 14213-14366
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0439
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 10010-10043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0463
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 12576-12609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0469
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 16421-16454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 19021-19042
Classification Level Classification E-value
Superfamily DPY module 0.051
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 10226-10258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0541
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 20109-20131
Classification Level Classification E-value
Superfamily DPY module 0.0549
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 8620-8779
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0565
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number - Region: 18395-18423
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0569
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 12993-13026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0587
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 20047-20067
Classification Level Classification E-value
Superfamily DPY module 0.0589
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 19930-19950
Classification Level Classification E-value
Superfamily DPY module 0.0732
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 11194-11227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0812
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 10870-10903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0868
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 1827-1946
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0879
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 19373-19416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.089
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 19603-19625
Classification Level Classification E-value
Superfamily DPY module 0.0994
Family DPY module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304621   Gene: FBgn0053196   Transcript: FBtr0332344
Sequence length 20710
Comment pep:known chromosome:BDGP5:2L:4479471:4591963:-1 gene:FBgn0053196 transcript:FBtr0332344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNE
STEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGY
GGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAAR
CVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP
DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD
ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGS
FQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQP
DGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFV
CTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACE
QVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNT
PGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAA
GCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKC
GAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPE
PNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAE
KAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCI
CRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEI
CNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSC
VDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAAN
EKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLL
GCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC
ASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGD
GALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVC
GIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPG
TFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK
PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQ
KGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICF
QLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEE
DKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNP
VVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCD
CLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAV
CVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEES
CGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKC
PPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVC
SCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNV
CVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCS
IDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAV
GERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIG
TPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCA
NNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHV
DCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQ
PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCE
RQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPC
SLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSP
LCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLS
DAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSN
DKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCG
PGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVC
AQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSV
CKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKE
CVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVC
LHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNP
TPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN
ECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCL
CPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRT
VCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVN
HGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKC
RNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTV
SEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCR
VVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAH
QGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRT
LGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTV
LHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCT
DPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMAC
SDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACR
KLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQ
AHQCGSSGKCIDPCLTSCAGGVKCVVSAHRVTICTCPATLTNNTDSNCTSTDITVGTTTQ
RIETTTDFINVKYTVMQLANQTEMRTRFTDIEAENETTGPYTTTTESYKTTKQLSSNPET
ETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSESTTREVYT
IKPFDRSTPTPVSPDTTVPSITFETTTNIPIGTTRGQVTEQTTSSPSEKRTTIRVEESTL
PSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNDPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTTPSESPETPT
TLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGG
QVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTES
TRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTSSPSEVRTTIR
VEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSA
SLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSE
SPETPTTLPSDFTIRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVP
IGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYS
DQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSE
VRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEA
STPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSAD
RTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLE
TTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDF
TTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQT
TSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRTYSDQTTESTRDVPT
TRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTL
PSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPT
LPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVPIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTECT
RDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRV
EESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSASL
ETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESP
ETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGS
TGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQT
TESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRT
TIGVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTP
SPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTS
PSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTT
NVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITR
PHSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSES
PETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQ
TTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVR
TTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTRDVPTTRPFEAST
PSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRT
TPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETT
TSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFIT
RPHSEKTTESTRDVPTTRPFEASTPSSASSGNNCSISYFRNHYKCSNRFNRSADRTTPSE
SPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPI
GSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEV
RTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEAS
TPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDR
TSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSET
TTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFI
TRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTT
SSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTT
QPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLP
SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLETAVP
PVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTT
LPSDFTTRPHSDQTTESTRDVPTTRPFESSTPRPVTLEIAVPPVTSETTTNVAIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTEST
RDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRV
EESTLPSRSTDRTPPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVT
LEIAVPPVTSETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSES
PETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTTNVPIGSTVTSETTTNVPIGSTG
GQVAGQTTAPPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTE
STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPSEVRTTI
RVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFETSTPSP
VSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDTTIPSE
IPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRDA
LETTVTSLITETTKTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERTMPSNISSTTTV
FNNSEPVSDNLPTTISITVTDSPTTVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCT
VQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTF
NNPCSRNEDCRVFNHQPLCSAEHGRTPGCEHCPPGANCDPTTGACIKANVTITTITTKNS
TSTKIPTKPRTTANPNTGVKTTPTTTRVTTRNTTTTTTTTTTSSTSTESSTITSATNQTS
KNQKPDTESTTSHTDATRRYRDGENNITDTPTPRPTIQTTTLRGEGVMGDSQRRSTTTPK
MKTTRLDTSNEVPDTTSPWPIELPTTEGTTTEVYNTMFAPVVNTTDTSLINPCTVDTNCA
PNEHCKLGHCRKKEPPGSPKTPEPCQSNNDCIESEACYMGLCQDPCEFAKICAATAKCTA
KSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQHPCDVHDPCATN
AVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQED
SCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQC
GAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPK
GLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCD
PSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHP
VCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGC
REPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSK
ACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSPC
GRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKCVDPCAGAICG
INAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGV
ALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNVYEHNPV
CACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKGYFGDPH
IGCRPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIA
CNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECA
PNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVP
KNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKACINEKCQN
PCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAV
CTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAEC
TVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVG
YFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEG
NPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVIN
QDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLD
PPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRPECVQNSDCPNNRACINMK
CRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCG
LFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCPGTCGYNA
RCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSS
GAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPV
CMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPY
VECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVG
CHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSS
SECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPI
THDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACI
NLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPC
GANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCPGVCGV
SAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVC
SCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCP
AGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPN
CRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCN
PQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSR
DKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERDE
NPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDP
CPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNS
KCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCT
VIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCAC
LPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCFD
GYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPEC
VVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEV
KNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQER
CVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCG
PHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNIC
GDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQ
AVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHTCGIRAICTTKNHSPIC
TCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFI
GAPPRCRPECVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDP
FVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSADC
PRDKACMRNRCVDPCPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIE
ACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDPC
AAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPN
SICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPCPESCGTNAEC
RVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEY
QGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYTG
DPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTV
NAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPP
PGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQA
CIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDP
CDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCPGVC
GQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVC
ACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHNPSCSCN
TGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCR
PECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPFTGCQKE
QAVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKC
FDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQC
REVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVV
NHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCL
GDFVGSPPYCKPECVANSECPSNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGL
TGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRPECV
LNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPI
VHEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNCRPQCTSSSECASNRACINQ
KCVDPCPGVCGQQAICEVRNHSPICRCPTAMIGDPFVRCIPRPTIAPPPLRDVAPYRDPC
LPSPCGLYASCRNQQNQAVCSCLPNYFGTPPHCRPECSINAECPSHLACIGERCRDPCPG
ACGQQTECRVISHVPSCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSN
QGECKCVADYQGDPYVACRPECVLSSECPRNLACIQQKCTDPCPGTCGTNAICDVVNHIA
MCHCPDRMTGNAFVQCTPVQLDVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPS
CRPECSTNYDCSPSLACQNQRCVDPCPGACGAYAECRTVNHSPFCSCRPGYTGNPIVQCH
MIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRPECVSNSECSQ
VHVCSNNRCKDPCPGLCGTDAVCRVISHSAMCYCQPGYSGDPFVRCAPHIQRESIEIVQP
CNPNPCGAFAECRQQNGVGSCQCLPEYFGNPYEGCRPECVLDSDCPSQLACVNQKCRDPC
PGSCGQNAECFVRNHLPTCNCLSGYVGDPYRYCSIEPKPIREYVNPCQPSPCGPNSQCRE
QNGVATCSCLPEFVGTPPGCRPECTVSSECNLDKACVRHKCLDPCPGACGSSANCQVVNH
APLCSCQAGYTGDPFTRCYPIPSPPTHIVHDYARHPCQPSPCGANAQCRQSQGQAICSCI
PNYFGVPPNCRPECTQSSECLSSLACINQRCADPCPGSCAYNAICHVRNHVPSCQCPVGY
VGDPFTNCHPEPQPPPKPVALDDPCNPSPCGANAVCQNGQCSCIPEYQGDPYTGCRPECV
LNADCPRNRACVRHKCVDPCPGTCAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSL
APPDPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQRQHC
IDPCPGTCGFNALCHVVNHAPICSCPPKHNGNPFLGCFPEPVRRDEVIPKNPCQPSPCGP
YAKCTSVGDQAQCSCLPEYIGTPPNCRPECITNSECSFDKACLNQRCRDPCSGTCGSNAN
CHVISHTAMCYCLPGFTGDPFTSCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQ
CLPEYYGNPYETCRPECVTNNDCPSNKACQQQKCRDPCPGVCALNALCRVINHLPTCHCQ
NGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCR
PECVTSAECPHDKACIRQKCNDPCPGVCGSNADCRVIQHAPICSCRAGFTGDAFSRCLPL
PPSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATCSCLPSYFGTPPNCRPECTINPDCPS
HLSCQQQRCRDPCPGACGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQIS
DPCDLITCGPNAVCNQGQCNCLPEFVGNPLVGCRPECVLSTECDWSKACVRNKCIDPCPG
TCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRDVIDPCQPSPCGPNAQCRNI
NGQAVCSCLRDFIGVPPSCRPECVSNAECPLHLACLQRHCRDPCPGVCGLNAECRVINHS
PNCHCIGSFTGNPFAACHRPPPPPIKHEPIDPCQPSPCGANAECRVQGSNAQCSCLSGFI
GTPPNCRPECVSNSDCPMNLACLNQKCRDPCPGVCGSNAECYVINHTPMCTCLAGQTGNP
FVSCQVVRDVPEPQTPCVPSPCGANALCSEGNGAGACKCLPEFYGNPYEGCRPECVLNSD
CPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPV
PSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPACRPECTISSECDLTLACVQQHCV
DPCPGVCGNSAQCRVINHSPHCSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVPSP
CGAFGQCRAQGNQAICSCLPGYYGAPPNCRPECAINPDCASHLACISEKCRDPCPGSCGL
QAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQCS
CLPDFDGNPYVGCRPECVLNTDCARDKACQRSKCTDPCPGACGIGAVCEVRNHIPTCNCP
PGTSGNAFVQCTLVQSSPVVPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRP
ECTINSDCAPHLACLNQQCRDPCPGACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLP
PPPPVQREPINPCYPSPCGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQL
ACIGQKCKDPCSGLCGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPIQREQINPCYQ
NPCGSNAVCRERGEAASCQCLPEYYGNPYEGCRPECVLNSDCSSHLACLNQHCRDPCPGS
CAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQPSPCGPNSQCTES
QGQAVCRCLPDYYGSPPACRPECTTNPECPNDKACVSRRCTDPCAGACGQNAICRAHQHR
AYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCL
TSYYGTPPYCRPECTQNSDCPSHRACVNQRCVDPCPGACGLNARCDVLNHVPSCSCPEGY
LGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNGVCSCLPLYQGDPYVGCRPE
CVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPL
QAPVELHPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPACRPECVSDPECPPSLACVN
QKCRDPCPGACGHLAQCHVINHSPQCVCPAGYTGSPYSECHLIRADSSPIQRQPIDPCLP
SPCGPHAQCSNEGGNAVCRCLTEYLGVPPYCRPECIANSECPSDRACINRKCQDPCPGLC
GYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATPPTTAIQVLQYEEPFINGCE
PNPCGANAQCNQRRGVVSCVCLPDYFGNPYEACRPECILNSDCPLSRACVQQKCRDPCPG
TCGLNAECHVMDHLPQCRCFSGYTGNPLAYCSPVPIIQESPLTPCDPSPCGPNAQCHPSL
NEAVCSCLPEFYGTPPNCRPECTLNSECAYDKACVHHKCVDPCPGICGINADCRVHYHSP
ICYCISSHTGDPFTRCYETPKPVRPQIYDTPSPPYPVAIPDLVYVQQQQPGIVNIPSAPQ
PIYPTPQSPQYNVNYPSPQPANPQKPGVVNIPSVPQPVYPSPQPPVYDVNYPTTPVSQHP
GVVNIPSAPRLVPPTSQRPVFITSPGNLSPTPQPGVINIPSVSQPGYPTPQSPIYDANYP
TTQSPIPQQPGVVNIPSVPSPSYPAPNPPVNYPTQPSPQIPVQPGVINIPSAPLPTTPPQ
HPPVFIPSPESPSPAPKPGVINIPSVTHPEYPTSQVPVYDVNYSTTPSPIPQKPGVVNIP
SAPQPVHPAPNPPVHEFNYPTPPAVPQQPGVLNIPSYPTPVAPTPQSPIYIPSQEQPKPT
TRPSVINVPSVPQPAYPTPQAPVYDVNYPTSPSVIPHQPGVVNIPSVPLPAPPVKQRPVF
VPSPVHPTPAPQPGVVNIPSVAQPVHPTYQPPVVERPAIYDVYYPPPPSRPGVINIPSPP
RPVYPVPQQPIYVPAPVLHIPAPRPVIHNIPSVPQPTYPHRNPPIQDVTYPAPQPSPPVP
GIVNIPSLPQPVSTPTSGVINIPSQASPPISVPTPGIVNIPSIPQPTPQRPSPGIINVPS
VPQPIPTAPSPGIINIPSVPQPLPSPTPGVINIPQQPTPPPLVQQPGIINIPSVQQPSTP
TTQHPIQDVQYETQRPQPTPGVINIPSVSQPTYPTQKPSYQDTSYPTVQPKPPVSGIINI
PSVPQPVPSLTPGVINLPSEPSYSAPIPKPGIINVPSIPEPIPSIPQNPVQEVYHDTQKP
QAIPGVVNVPSAPQPTPGRPYYDVAKPDFEFNPCYPSPCGPYSHCHNRFGVAACVCLPNY
RGTPPNCRPECVINSDCPSSLACINEKCRDPCPGSCAYNAVCRVHEHVPNCYCQTGYTGN
PFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVCNNGKCSCIPEYRGDPYVGCRPECVL
NTDCARDKACIQQKCKNPCPGTCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQP
PAPAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTPPGCRPECT
SNSDCPLDKYCLNLRCRDPCPGACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPP
VERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPFCRPECVNSADCPADKACRN
YKCIDPCPGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPC
GVNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTVNSDCPSHRACMSEKCRDPCPGVCGL
NALCQVINHSPVCECHTGHVGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQ
AICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLC
SCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVG
AAPNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPF
TSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCP
RNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTP
NPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDP
CPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQ
CTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCPGSCGQSAQCTV
SLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCE
CSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSC
PPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGC
RPECTLSSDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEE
PRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNAC
GINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCR
NPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQC
VDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNER
CEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFG
GECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHD
QCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKT
GCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYK
PECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISC
ITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHV
QCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACK
CPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTAR
DHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADD
CGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCAS
PCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCL
ASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPC
GQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDD
KCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQ
DCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECD
SGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDC
PTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQL
DTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKP
TPGIKEVGGCISDSDCPTDKSCLNSVCRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEF
ECSKIECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARI
ACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKN
GCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECL
EGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESG
HCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKT
CEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTNFRTDFPRPDMVVSCLAD
GVQVEIHITEPGFNGVLYVKGHSKDEECRRVVNLAGETVPRTEIFRVHFGSCGMQAVKDV
ASFVLVIQKHPKLVTYKAQAYNIKCVYQTGEKNVTLGFNVSMLTTAGTIANTGPPPICQM
RIITNEGEEINSAEIGDNLKLQVDVEPATIYGGFARSCIAKTMEDNVQNEYLVTDENGCA
TDTSIFGNWEYNPDTNSLLASFNAFKFPSSDNIRFQCNIRVCFGRCQPVNCGGYNAFGRR
RRSIADNSTDATAIATNSGVEGQLREEITISSNAILTFEKRSGQGLNDANIKPAAQRVED
ICVSMVGLIIALVITALLALVAVAVAVSCWLMAYRRRPKTIAPLPHPPEFPNPLFSNPDA
VPEPTPDYIS
Download sequence
Identical sequences M9PEH5
NP_001260031.1.81976 FBpp0304621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]