SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304623 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304623
Domain Number 1 Region: 271-378
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000122
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 181-297
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000033
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 3 Region: 504-640
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000816
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 4 Region: 2270-2314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000021
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 5 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000223
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 373-506
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000518
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 2102-2140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000659
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 13983-14006
Classification Level Classification E-value
Superfamily DPY module 0.00000484
Family DPY module 0.00058
Further Details:      
 
Domain Number 9 Region: 20230-20253
Classification Level Classification E-value
Superfamily DPY module 0.00000536
Family DPY module 0.00085
Further Details:      
 
Domain Number 10 Region: 1215-1355
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000659
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 11 Region: 10145-10168
Classification Level Classification E-value
Superfamily DPY module 0.00000837
Family DPY module 0.001
Further Details:      
 
Domain Number 12 Region: 17067-17090
Classification Level Classification E-value
Superfamily DPY module 0.00000929
Family DPY module 0.00093
Further Details:      
 
Domain Number 13 Region: 13877-13900
Classification Level Classification E-value
Superfamily DPY module 0.00000942
Family DPY module 0.00098
Further Details:      
 
Domain Number 14 Region: 19468-19491
Classification Level Classification E-value
Superfamily DPY module 0.00000994
Family DPY module 0.00087
Further Details:      
 
Domain Number 15 Region: 13564-13587
Classification Level Classification E-value
Superfamily DPY module 0.0000122
Family DPY module 0.001
Further Details:      
 
Domain Number 16 Region: 10480-10634
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000138
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 17 Region: 840-951
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000141
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 18 Region: 15151-15174
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.00091
Further Details:      
 
Domain Number 19 Region: 18474-18497
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.00095
Further Details:      
 
Domain Number 20 Region: 20025-20185
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 21 Region: 15579-15602
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.0012
Further Details:      
 
Domain Number 22 Region: 15896-15919
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.00087
Further Details:      
 
Domain Number 23 Region: 14622-14645
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.00091
Further Details:      
 
Domain Number 24 Region: 14725-14748
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.0013
Further Details:      
 
Domain Number 25 Region: 17172-17195
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.00093
Further Details:      
 
Domain Number 26 Region: 11218-11241
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.0011
Further Details:      
 
Domain Number 27 Region: 15256-15279
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.00083
Further Details:      
 
Domain Number 28 Region: 14516-14539
Classification Level Classification E-value
Superfamily DPY module 0.0000235
Family DPY module 0.001
Further Details:      
 
Domain Number 29 Region: 9822-9845
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.00089
Further Details:      
 
Domain Number 30 Region: 16427-16450
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.0014
Further Details:      
 
Domain Number 31 Region: 13669-13692
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.0013
Further Details:      
 
Domain Number 32 Region: 9715-9738
Classification Level Classification E-value
Superfamily DPY module 0.0000327
Family DPY module 0.001
Further Details:      
 
Domain Number 33 Region: 10683-10706
Classification Level Classification E-value
Superfamily DPY module 0.0000327
Family DPY module 0.0012
Further Details:      
 
Domain Number 34 Region: 1022-1064
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family EGF-type module 0.016
Further Details:      
 
Domain Number 35 Region: 10790-10813
Classification Level Classification E-value
Superfamily DPY module 0.0000353
Family DPY module 0.0013
Further Details:      
 
Domain Number 36 Region: 14199-14222
Classification Level Classification E-value
Superfamily DPY module 0.0000366
Family DPY module 0.00093
Further Details:      
 
Domain Number 37 Region: 16216-16239
Classification Level Classification E-value
Superfamily DPY module 0.0000366
Family DPY module 0.0011
Further Details:      
 
Domain Number 38 Region: 18031-18054
Classification Level Classification E-value
Superfamily DPY module 0.0000379
Family DPY module 0.0011
Further Details:      
 
Domain Number 39 Region: 18138-18161
Classification Level Classification E-value
Superfamily DPY module 0.0000379
Family DPY module 0.0019
Further Details:      
 
Domain Number 40 Region: 17813-17836
Classification Level Classification E-value
Superfamily DPY module 0.0000392
Family DPY module 0.0011
Further Details:      
 
Domain Number 41 Region: 12817-12840
Classification Level Classification E-value
Superfamily DPY module 0.0000405
Family DPY module 0.0013
Further Details:      
 
Domain Number 42 Region: 13453-13476
Classification Level Classification E-value
Superfamily DPY module 0.0000405
Family DPY module 0.0015
Further Details:      
 
Domain Number 43 Region: 19910-19933
Classification Level Classification E-value
Superfamily DPY module 0.0000445
Family DPY module 0.001
Further Details:      
 
Domain Number 44 Region: 707-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000446
Family EGF-type module 0.012
Further Details:      
 
Domain Number 45 Region: 13241-13264
Classification Level Classification E-value
Superfamily DPY module 0.0000484
Family DPY module 0.0014
Further Details:      
 
Domain Number 46 Region: 9399-9422
Classification Level Classification E-value
Superfamily DPY module 0.0000497
Family DPY module 0.0013
Further Details:      
 
Domain Number 47 Region: 9079-9102
Classification Level Classification E-value
Superfamily DPY module 0.0000575
Family DPY module 0.0015
Further Details:      
 
Domain Number 48 Region: 9610-9633
Classification Level Classification E-value
Superfamily DPY module 0.0000575
Family DPY module 0.0017
Further Details:      
 
Domain Number 49 Region: 17707-17730
Classification Level Classification E-value
Superfamily DPY module 0.0000602
Family DPY module 0.0016
Further Details:      
 
Domain Number 50 Region: 18579-18602
Classification Level Classification E-value
Superfamily DPY module 0.0000602
Family DPY module 0.0018
Further Details:      
 
Domain Number 51 Region: 19575-19598
Classification Level Classification E-value
Superfamily DPY module 0.0000615
Family DPY module 0.0014
Further Details:      
 
Domain Number 52 Region: 20555-20578
Classification Level Classification E-value
Superfamily DPY module 0.0000667
Family DPY module 0.0011
Further Details:      
 
Domain Number 53 Region: 11648-11671
Classification Level Classification E-value
Superfamily DPY module 0.0000706
Family DPY module 0.0012
Further Details:      
 
Domain Number 54 Region: 14410-14433
Classification Level Classification E-value
Superfamily DPY module 0.0000706
Family DPY module 0.0014
Further Details:      
 
Domain Number 55 Region: 12070-12093
Classification Level Classification E-value
Superfamily DPY module 0.0000719
Family DPY module 0.0013
Further Details:      
 
Domain Number 56 Region: 16534-16557
Classification Level Classification E-value
Superfamily DPY module 0.0000824
Family DPY module 0.001
Further Details:      
 
Domain Number 57 Region: 2627-2671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000891
Family EGF-type module 0.025
Further Details:      
 
Domain Number 58 Region: 17296-17450
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000091
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number 59 Region: 16640-16663
Classification Level Classification E-value
Superfamily DPY module 0.0000968
Family DPY module 0.0015
Further Details:      
 
Weak hits

Sequence:  FBpp0304623
Domain Number - Region: 9507-9530
Classification Level Classification E-value
Superfamily DPY module 0.000107
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 12926-12949
Classification Level Classification E-value
Superfamily DPY module 0.000114
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 13031-13054
Classification Level Classification E-value
Superfamily DPY module 0.000114
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 16854-16877
Classification Level Classification E-value
Superfamily DPY module 0.000114
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 9929-9952
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 12495-12518
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 15362-15385
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 16001-16024
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 12287-12310
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 15043-15066
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 17599-17622
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 10365-10388
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 11752-11775
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 11857-11880
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 20753-20775
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 18251-18411
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000188
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number - Region: 9185-9207
Classification Level Classification E-value
Superfamily DPY module 0.000196
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 10898-10921
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 15474-15497
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 791-832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000213
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 9291-9314
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 14090-14113
Classification Level Classification E-value
Superfamily DPY module 0.000235
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 17494-17517
Classification Level Classification E-value
Superfamily DPY module 0.000235
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 13347-13370
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 14306-14329
Classification Level Classification E-value
Superfamily DPY module 0.000275
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 20661-20683
Classification Level Classification E-value
Superfamily DPY module 0.000314
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 12708-12731
Classification Level Classification E-value
Superfamily DPY module 0.000327
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 12393-12416
Classification Level Classification E-value
Superfamily DPY module 0.00034
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 11128-11276
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000345
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 11967-11990
Classification Level Classification E-value
Superfamily DPY module 0.000353
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 13772-13795
Classification Level Classification E-value
Superfamily DPY module 0.000379
Family DPY module 0.0011
Further Details:      
 
Domain Number - Region: 10039-10062
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 16960-16983
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 17279-17302
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0026
Further Details:      
 
Domain Number - Region: 20444-20467
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 11006-11029
Classification Level Classification E-value
Superfamily DPY module 0.000432
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 15587-15739
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000439
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number - Region: 14799-14898
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000487
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 18204-18238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00055
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 13133-13156
Classification Level Classification E-value
Superfamily DPY module 0.000602
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 12601-12624
Classification Level Classification E-value
Superfamily DPY module 0.000759
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 10255-10278
Classification Level Classification E-value
Superfamily DPY module 0.000837
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 16749-16772
Classification Level Classification E-value
Superfamily DPY module 0.00085
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 17561-17594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000904
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 19705-19860
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000926
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number - Region: 15701-15848
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00126
Family Growth factor receptor domain 0.0074
Further Details:      
 
Domain Number - Region: 11538-11561
Classification Level Classification E-value
Superfamily DPY module 0.00131
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 2223-2382
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00157
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 12176-12199
Classification Level Classification E-value
Superfamily DPY module 0.0017
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 14631-14784
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00173
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 16075-16171
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00173
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 14940-14963
Classification Level Classification E-value
Superfamily DPY module 0.00183
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 21200-21223
Classification Level Classification E-value
Superfamily DPY module 0.00209
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 2513-2676
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0022
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 21330-21353
Classification Level Classification E-value
Superfamily DPY module 0.00235
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 17773-17807
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00243
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 9676-9710
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00262
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 17825-17982
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00282
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 11820-11852
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00288
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 17669-17702
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00298
Family Merozoite surface protein 1 (MSP-1) 0.061
Further Details:      
 
Domain Number - Region: 8971-8994
Classification Level Classification E-value
Superfamily DPY module 0.00301
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 20819-20842
Classification Level Classification E-value
Superfamily DPY module 0.00353
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 11930-11962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00379
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 15159-15315
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00408
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 757-806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 20352-20503
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00463
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 9467-9500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00472
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 16923-16955
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00512
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 19658-19691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00568
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 19979-20012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00708
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 20941-20964
Classification Level Classification E-value
Superfamily DPY module 0.00772
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 9574-9605
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00839
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 9937-10097
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00942
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 17242-17274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0101
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 8651-8687
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0128
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 11322-11345
Classification Level Classification E-value
Superfamily DPY module 0.0144
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 20299-20332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0147
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 21976-21998
Classification Level Classification E-value
Superfamily DPY module 0.0157
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 13885-14041
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0173
Family Growth factor receptor domain 0.0074
Further Details:      
 
Domain Number - Region: 17029-17062
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0173
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 8870-8891
Classification Level Classification E-value
Superfamily DPY module 0.0183
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 14418-14573
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0188
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 10859-10893
Classification Level Classification E-value
Superfamily EGF/Laminin 0.019
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 20337-20360
Classification Level Classification E-value
Superfamily DPY module 0.0222
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 12507-12660
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0228
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 11391-11424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0238
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 19429-19463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0242
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 671-719
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0262
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 20622-20654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0288
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 18436-18468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0291
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 16329-16486
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0298
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 15439-15535
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0314
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number - Region: 13356-13516
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.033
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 8515-8547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0341
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 12891-12988
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0345
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 16710-16744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 11285-11317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0367
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 13839-13872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family EGF-type module 0.055
Further Details:      
 
Domain Number - Region: 12781-12879
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0392
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 14583-14616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0405
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 13528-13623
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0424
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 19874-19904
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0447
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 14053-14149
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0487
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 9891-9924
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0492
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 18541-18574
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0493
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 8932-8965
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0503
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 9194-9350
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0534
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 10968-11001
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0536
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 13735-13767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0549
Family EGF-like domain of nidogen-1 0.051
Further Details:      
 
Domain Number - Region: 12457-12490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.055
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 21141-21162
Classification Level Classification E-value
Superfamily DPY module 0.0562
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 22229-22251
Classification Level Classification E-value
Superfamily DPY module 0.0615
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 12667-12702
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0637
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 22167-22187
Classification Level Classification E-value
Superfamily DPY module 0.0654
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 15113-15146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0665
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 20515-20543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0709
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 13096-13128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0823
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 22050-22070
Classification Level Classification E-value
Superfamily DPY module 0.0824
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 13310-13341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0871
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 10751-10784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0958
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304623   Gene: FBgn0053196   Transcript: FBtr0332346
Sequence length 22830
Comment pep:known chromosome:BDGP5:2L:4479471:4591963:-1 gene:FBgn0053196 transcript:FBtr0332346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNE
STEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGY
GGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAAR
CVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP
DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD
ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDINECQDNPCGENAICTDTVGSF
VCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVAC
EQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLN
TPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVA
AGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASK
CGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCP
EPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCA
EKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVC
ICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCE
ICNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGS
CVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAA
NEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPL
LGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDD
CASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICG
DGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVV
CGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNP
GTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECAN
KPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSC
QKGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEIC
FQLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEE
EDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWN
PVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRC
DCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRA
VCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEE
SCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCK
CPPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPV
CSCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKN
VCVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALC
SIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCA
VGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFI
GTPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDC
ANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDH
VDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLS
QPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPC
ERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDP
CSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICS
PLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCL
SDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCS
NDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPC
GPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDV
CAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDS
VCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAK
ECVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHV
CLHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPN
PTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHD
NECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQC
LCPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCR
TVCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVV
NHGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGK
CRNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCT
VSEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQC
RVVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDA
HQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCR
TLGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKT
VLHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQC
TDPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMA
CSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQAC
RKLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCS
QAHQCGSSGKCIDPCLTSCAGGVKCVVSAHRVTICTCPATLTNNTDSNCTSTDITVGTTT
QRIETTTDFINVKYTVMQLANQTEMRTRFTDIEAENETTGPYTTTTESYKTTKQLSSNPE
TETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSESTTREVY
TIKPFDRSTPTPVSPDTTVPSITFETTTNIPIGTTRGQVTEQTTSSPSEKRTTIRVEEST
LPSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETT
VPSVTLETTTNDPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTTPSESPETP
TTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTG
GQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTE
STRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTSSPSEVRTTI
RVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSS
ASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLS
ESPETPTTLPSDFTIRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNV
PIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTY
SDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPS
EVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFE
ASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSA
DRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTL
ETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSD
FTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQ
TTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRTYSDQTTESTRDVP
TTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEEST
LPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETT
VPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETP
TLPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVPIGSTGG
QVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTEC
TRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIR
VEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSAS
LETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSES
PETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIG
STGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQ
TTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVR
TTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEAST
PSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRT
SPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETT
TNVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFIT
RPHSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSE
SPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTNVP
IGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSE
QTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEV
RTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTRDVPTTRPFEAS
TPSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDR
TTPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLET
TTSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFI
TRPHSEKTTESTRDVPTTRPFEASTPSSASSGNNCSISYFRNHYKCSNRFNRSADRTTPS
ESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVP
IGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDFTTRPHS
DQTTESTRDVPTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATPSE
VRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEA
STPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTD
RTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSE
TTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDF
ITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQT
TSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPT
TQPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTL
PSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLETAV
PPVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPT
TLPSDFTTRPHSDQTTESTRDVPTTRPFESSTPRPVTLEIAVPPVTSETTTNVAIGSTGG
QVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTES
TRDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIR
VEESTLPSRSTDRTPPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPV
TLEIAVPPVTSETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSE
SPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVP
IGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHS
DQTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTTNVPIGSTVTSETTTNVPIGST
GGQVAGQTTAPPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTT
ESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPSEVRTT
IRVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFETSTPS
PVSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDTTIPS
EIPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRD
ALETTVTSLITETTKTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERTMPSNISSTTT
VFNNSEPVSDNLPTTISITVTDSPTTVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLC
TVQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCT
FNNPCSRNEDCRVFNHQPLCSAEHGRTPGCEHCPPGANCDPTTGACIKANVTITTITTKN
STSTKIPTKPRTTANPNTGVKTTPTTTRVTTRNTTTTTTTTTTSSTSTESSTITSATNQT
SKNQKPDTESTTSHTDATRRYRDGENNITDTPTPRPTIQTTTLRGEGVMGDSQRRSTTTP
KMKTTRLDTSNEVPDTTSPWPIELPTTEGTTTEVYNTMFAPVVNTTDTSLINPCTVDTNC
APNEHCKLGHCRKKEPPGSPKTPEPCQSNNDCIESEACYMGLCQDPCEFAKICAATAKCT
AKSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQHPCDVHDPCAT
NAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQE
DSCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQ
CGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCP
KGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPC
DPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRH
PVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQG
CREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNS
KACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSP
CGRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKCVDPCAGAIC
GINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDG
VALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNVYEHNP
VCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKGYFGDP
HIGCRPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASI
ACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSEC
APNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPV
PKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKACINEKCQ
NPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENA
VCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAE
CTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQV
GYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYE
GNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVI
NQDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVL
DPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRPECVQNSDCPNNRACINM
KCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPC
GLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCPGTCGYN
ARCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSS
SGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGNNALCHVSLHAP
VCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDP
YVECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIV
GCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMS
SSECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPP
ITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLAC
INLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSP
CGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCPGVCG
VSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAV
CSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSC
PAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAP
NCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGC
NPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCS
RDKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERD
ENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVD
PCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPN
SKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVC
TVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCA
CLPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCF
DGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPE
CVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPE
VKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQE
RCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPC
GPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNI
CGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNN
QAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHTCGIRAICTTKNHSPI
CTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNF
IGAPPRCRPECVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGD
PFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSAD
CPRDKACMRNRCVDPCPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPII
EACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDP
CAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGP
NSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPCPESCGTNAE
CRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDE
YQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYT
GDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECT
VNAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPP
PPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQ
ACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQD
PCDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCPGV
CGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPV
CACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHNPSCSC
NTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSC
RPECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPFTGCQK
EQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRPECVRHSDCASN
KACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPS
QPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTDKACISQRCQDP
CPGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLN
SQCRNVQGVPSCTCLPDFLGAPPNCRPECTISAECPSNLACIRERCIDPCPGSCGYAAEC
SVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNAQCNAGICTCLA
EFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGTCGENAICDVINHIPMCRCPERT
AGSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSCLPSFIGAPPSCRPECTSNS
ECAPTQACLNQRCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPFIRCQPQIEPPVRD
VAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECVTSSDCSSQLACVNQK
CVDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPN
AVCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQDPCPGTCGLNAN
CQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCS
CLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADTCGNNAICRVRNHSPICSCI
SGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLVNFIGQA
PNCRPECTINSECPSQLACINQKCRDPCPGACGQNAVCSVINHTPLCACIDGYIGNPFTN
CNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPR
DRACVRNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGNAFFECRPVPPAKIQNPCQP
SPCGPNSQCRVVQQTAVCSCLANYVGSPPQCRPECVTNSDCPADQDCQNMKCRDPCPGTC
GFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGPNSECRVSGDS
PSCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPCPGLCGQNAICRVFSHSAMC
LCDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPCGVNAKCEERGGAGSCQCLPDYFGNPYD
GCRPECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLATCNCLVGYTGDPYSIC
RITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSECA
ADKACVNRKCVDPCPNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPPVVERE
PLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCRPECSINAECPSHQACINQKCR
DPCPGSCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPCNPSPC
GSNTQCNNGVCSCLPEYHGDPYTGCRPECVLHTDCDRSRACVRHKCVDPCPGTCGTNAIC
EVLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAICSCIT
SFIGSPPFCRPECTTNSECPLNLACRNQKCSDPCPGVCGRGAQCHVTNHSPFCRCLERYT
GNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECV
TSSECPTNQACIQQKCRDPCPGLCGQSAECRVLSHTPSCVCPEGMEGDPFTLCKEKRIQE
LDQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCRPECVLNSDCPSNKACQQQ
KCQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNS
QCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCPNTCGDQAICR
VVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYSQCRSQGDAPA
CSCLVGYIGAPPNCRPECRINAECPSSQACINEKCRDPCPGSCGYGAICNVINHTPSCTC
PPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCR
PECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPT
PPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSHLACVN
QKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPS
PCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPCPGLCG
SSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGA
CQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCN
CFAGFIGDPYRYCSQPPEPIVHEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPN
CRPQCTSSSECASNRACINQKCVDPCPGVCGQQAICEVRNHSPICRCPTAMIGDPFVRCI
PRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGTPPHCRPECSIN
AECPSHLACIGERCRDPCPGACGQQTECRVISHVPSCVCLRGYVGDAFLACHPAPPPPSR
EEPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACRPECVLSSECPRNLACIQQKCT
DPCPGTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPVQLDVYRNPCNPSPCGSYAECR
EQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQNQRCVDPCPGACGAYAECRTVN
HSPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSCSCLSN
FFGTPPNCRPECVSNSECSQVHVCSNNRCKDPCPGLCGTDAVCRVISHSAMCYCQPGYSG
DPFVRCAPHIQRESIEIVQPCNPNPCGAFAECRQQNGVGSCQCLPEYFGNPYEGCRPECV
LDSDCPSQLACVNQKCRDPCPGSCGQNAECFVRNHLPTCNCLSGYVGDPYRYCSIEPKPI
REYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTPPGCRPECTVSSECNLDKACVRHK
CLDPCPGACGSSANCQVVNHAPLCSCQAGYTGDPFTRCYPIPSPPTHIVHDYARHPCQPS
PCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSECLSSLACINQRCADPCPGSCA
YNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCNPSPCGANAVCQNGQ
CSCIPEYQGDPYTGCRPECVLNADCPRNRACVRHKCVDPCPGTCAPNAICDVINHIAMCR
CPERMTGNAFIQCETPPVSLAPPDPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCR
PECTHNSDCLPRLACQRQHCIDPCPGTCGFNALCHVVNHAPICSCPPKHNGNPFLGCFPE
PVRRDEVIPKNPCQPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNCRPECITNSECSFDK
ACLNQRCRDPCSGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPVIQQAEIVQPCS
PNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCRPECVTNNDCPSNKACQQQKCRDPCPG
VCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNSQCREN
NEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCRVIQHA
PICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATCSCLPS
YFGTPPNCRPECTINPDCPSHLSCQQQRCRDPCPGACGFNALCTVINHNPTCQCAPGFIG
NAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQCNCLPEFVGNPLVGCRPECVLS
TECDWSKACVRNKCIDPCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVR
DVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGVPPSCRPECVSNAECPLHLACLQRHC
RDPCPGVCGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPPIKHEPIDPCQPSPCGA
NAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRDPCPGVCGSNAE
CYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCGANALCSEGNGAGACKCL
PEFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQCNCHVG
YQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPACRP
ECTISSECDLTLACVQQHCVDPCPGVCGNSAQCRVINHSPHCSCLPGFTGDAISGCQRIP
PAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAPPNCRPECAINPDCA
SHLACISEKCRDPCPGSCGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHD
ACNPSPCGSNAICSPGGQCSCLPDFDGNPYVGCRPECVLNTDCARDKACQRSKCTDPCPG
ACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTLVQSSPVVPLNPCQPSPCGNNAQCREVN
DQAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQCRDPCPGACGQFAQCQVIRHVP
HCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCGPNAECTNQNEQAICKCLKDYI
GTPPNCRPECITSSECPIQLACIGQKCKDPCSGLCGIAATCQVVSHVPSCICIADYIGDP
YTGCYARPPIQREQINPCYQNPCGSNAVCRERGEAASCQCLPEYYGNPYEGCRPECVLNS
DCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQV
VHFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRPECTTNPECPNDKACVSRRC
TDPCAGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPS
PCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRPECTQNSDCPSHRACVNQRCVDPCPGACG
LNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSN
GVCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAM
CQCPVGYQGNPFVLCQQTPLQAPVELHPCQPSPCGHHGECREVGSQAICTCRLGYYGSPP
ACRPECVSDPECPPSLACVNQKCRDPCPGACGHLAQCHVINHSPQCVCPAGYTGSPYSEC
HLIRADSSPIQRQPIDPCLPSPCGPHAQCSNEGGNAVCRCLTEYLGVPPYCRPECIANSE
CPSDRACINRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPAT
PPTTAIQVLQYEEPFINGCEPNPCGANAQCNQRRGVVSCVCLPDYFGNPYEACRPECILN
SDCPLSRACVQQKCRDPCPGTCGLNAECHVMDHLPQCRCFSGYTGNPLAYCSPVPIIQES
PLTPCDPSPCGPNAQCHPSLNEAVCSCLPEFYGTPPNCRPECTLNSECAYDKACVHHKCV
DPCPGICGINADCRVHYHSPICYCISSHTGDPFTRCYETPKPVRPQIYDTPSPPYPVAIP
DLVYVQQQQPGIVNIPSAPQPIYPTPQSPQYNVNYPSPQPANPQKPGVVNIPSVPQPVYP
SPQPPVYDVNYPTTPVSQHPGVVNIPSAPRLVPPTSQRPVFITSPGNLSPTPQPGVINIP
SVSQPGYPTPQSPIYDANYPTTQSPIPQQPGVVNIPSVPSPSYPAPNPPVNYPTQPSPQI
PVQPGVINIPSAPLPTTPPQHPPVFIPSPESPSPAPKPGVINIPSVTHPEYPTSQVPVYD
VNYSTTPSPIPQKPGVVNIPSAPQPVHPAPNPPVHEFNYPTPPAVPQQPGVLNIPSYPTP
VAPTPQSPIYIPSQEQPKPTTRPSVINVPSVPQPAYPTPQAPVYDVNYPTSPSVIPHQPG
VVNIPSVPLPAPPVKQRPVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTYQPPVVERPAIY
DVYYPPPPSRPGVINIPSPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHNIPSVPQPTYPH
RNPPIQDVTYPAPQPSPPVPGIVNIPSLPQPVSTPTSGVINIPSQASPPISVPTPGIVNI
PSIPQPTPQRPSPGIINVPSVPQPIPTAPSPGIINIPSVPQPLPSPTPGVINIPQQPTPP
PLVQQPGIINIPSVQQPSTPTTQHPIQDVQYETQRPQPTPGVINIPSVSQPTYPTQKPSY
QDTSYPTVQPKPPVSGIINIPSVPQPVPSLTPGVINLPSEPSYSAPIPKPGIINVPSIPE
PIPSIPQNPVQEVYHDTQKPQAIPGVVNVPSAPQPTPGRPYYDVAKPDFEFNPCYPSPCG
PYSHCHNRFGVAACVCLPNYRGTPPNCRPECVINSDCPSSLACINEKCRDPCPGSCAYNA
VCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVCNNGKC
SCIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPGTCGLQALCHVYNHVATCSC
PEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQA
ICYCLPNFIGTPPGCRPECTSNSDCPLDKYCLNLRCRDPCPGACGIRAICHVQNHGPLCV
CPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPP
FCRPECVNSADCPADKACRNYKCIDPCPGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLC
SRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTVNSDCP
SHRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQREPPAPEYV
NPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDP
CPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPY
SQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQC
SVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPE
YHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMT
GNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLEC
YSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVP
RVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACM
NQKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCY
PSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCP
GVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQN
EKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGECGFGAVCQTINH
SPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINED
CSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKP
ECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYL
LGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCE
RPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVP
TQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVG
EADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSC
PERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNS
RPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQ
NHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICV
GRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVC
TPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNG
NCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDD
CPRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVG
CKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRS
DDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECH
SDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRP
VEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPD
ASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGF
EGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSG
YRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPV
DFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVR
TMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCNCGLNAECR
IKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCL
AIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELC
KVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGV
NAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALD
IYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPP
ECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCN
HTNFRTDFPRPDMVVSCLADGVQVEIHITEPGFNGVLYVKGHSKDEECRRVVNLAGETVP
RTEIFRVHFGSCGMQAVKDVASFVLVIQKHPKLVTYKAQAYNIKCVYQTGEKNVTLGFNV
SMLTTAGTIANTGPPPICQMRIITNEGEEINSAEIGDNLKLQVDVEPATIYGGFARSCIA
KTMEDNVQNEYLVTDENGCATDTSIFGNWEYNPDTNSLLASFNAFKFPSSDNIRFQCNIR
VCFGRCQPVNCGGYNAFGRRRRSIADNSTDATAIATNSGVEGQLREEITISSNAILTFEK
RSGQGLNDANIKPAAQRVEDICVSMVGLIIALVITALLALVAVAVAVSCWLMAYRRRPKT
IAPLPHPPEFPNPLFSNPDAVPEPTPDYIS
Download sequence
Identical sequences M9PBZ0
FBpp0304623 NP_001260033.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]