SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304624 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304624
Domain Number 1 Region: 264-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000116
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 2 Region: 181-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000361
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 623-760
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000361
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 4 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000013
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 2389-2433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000015
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 6 Region: 492-625
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000392
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 2221-2259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000503
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 454-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000619
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 408-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000023
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 9794-9817
Classification Level Classification E-value
Superfamily DPY module 0.00000379
Family DPY module 0.00058
Further Details:      
 
Domain Number 11 Region: 16041-16064
Classification Level Classification E-value
Superfamily DPY module 0.00000432
Family DPY module 0.00085
Further Details:      
 
Domain Number 12 Region: 1429-1467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000483
Family EGF-type module 0.028
Further Details:      
 
Domain Number 13 Region: 5956-5979
Classification Level Classification E-value
Superfamily DPY module 0.00000667
Family DPY module 0.001
Further Details:      
 
Domain Number 14 Region: 9688-9711
Classification Level Classification E-value
Superfamily DPY module 0.00000745
Family DPY module 0.00098
Further Details:      
 
Domain Number 15 Region: 12878-12901
Classification Level Classification E-value
Superfamily DPY module 0.00000745
Family DPY module 0.00093
Further Details:      
 
Domain Number 16 Region: 15279-15302
Classification Level Classification E-value
Superfamily DPY module 0.00000785
Family DPY module 0.00087
Further Details:      
 
Domain Number 17 Region: 9375-9398
Classification Level Classification E-value
Superfamily DPY module 0.00000968
Family DPY module 0.001
Further Details:      
 
Domain Number 18 Region: 6291-6445
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000973
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 19 Region: 958-1070
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000115
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 20 Region: 10962-10985
Classification Level Classification E-value
Superfamily DPY module 0.0000124
Family DPY module 0.00091
Further Details:      
 
Domain Number 21 Region: 14285-14308
Classification Level Classification E-value
Superfamily DPY module 0.0000126
Family DPY module 0.00095
Further Details:      
 
Domain Number 22 Region: 15836-15996
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000151
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 23 Region: 10536-10559
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.0013
Further Details:      
 
Domain Number 24 Region: 11390-11413
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.0012
Further Details:      
 
Domain Number 25 Region: 11707-11730
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.00087
Further Details:      
 
Domain Number 26 Region: 826-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000167
Family EGF-type module 0.012
Further Details:      
 
Domain Number 27 Region: 7029-7052
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.0011
Further Details:      
 
Domain Number 28 Region: 10433-10456
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.00091
Further Details:      
 
Domain Number 29 Region: 11067-11090
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.00083
Further Details:      
 
Domain Number 30 Region: 12983-13006
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.00093
Further Details:      
 
Domain Number 31 Region: 10327-10350
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.001
Further Details:      
 
Domain Number 32 Region: 14163-14186
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.0011
Further Details:      
 
Domain Number 33 Region: 12238-12261
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.0014
Further Details:      
 
Domain Number 34 Region: 5633-5656
Classification Level Classification E-value
Superfamily DPY module 0.0000235
Family DPY module 0.00089
Further Details:      
 
Domain Number 35 Region: 9480-9503
Classification Level Classification E-value
Superfamily DPY module 0.0000248
Family DPY module 0.0013
Further Details:      
 
Domain Number 36 Region: 1141-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.016
Further Details:      
 
Domain Number 37 Region: 5526-5549
Classification Level Classification E-value
Superfamily DPY module 0.0000262
Family DPY module 0.001
Further Details:      
 
Domain Number 38 Region: 6494-6517
Classification Level Classification E-value
Superfamily DPY module 0.0000262
Family DPY module 0.0012
Further Details:      
 
Domain Number 39 Region: 6601-6624
Classification Level Classification E-value
Superfamily DPY module 0.0000275
Family DPY module 0.0013
Further Details:      
 
Domain Number 40 Region: 10010-10033
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.00093
Further Details:      
 
Domain Number 41 Region: 12027-12050
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.0011
Further Details:      
 
Domain Number 42 Region: 13842-13865
Classification Level Classification E-value
Superfamily DPY module 0.0000301
Family DPY module 0.0011
Further Details:      
 
Domain Number 43 Region: 13949-13972
Classification Level Classification E-value
Superfamily DPY module 0.0000301
Family DPY module 0.0019
Further Details:      
 
Domain Number 44 Region: 13624-13647
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.0011
Further Details:      
 
Domain Number 45 Region: 8628-8651
Classification Level Classification E-value
Superfamily DPY module 0.0000327
Family DPY module 0.0013
Further Details:      
 
Domain Number 46 Region: 9264-9287
Classification Level Classification E-value
Superfamily DPY module 0.0000327
Family DPY module 0.0015
Further Details:      
 
Domain Number 47 Region: 15721-15744
Classification Level Classification E-value
Superfamily DPY module 0.0000353
Family DPY module 0.001
Further Details:      
 
Domain Number 48 Region: 9052-9075
Classification Level Classification E-value
Superfamily DPY module 0.0000379
Family DPY module 0.0014
Further Details:      
 
Domain Number 49 Region: 5210-5233
Classification Level Classification E-value
Superfamily DPY module 0.0000392
Family DPY module 0.0013
Further Details:      
 
Domain Number 50 Region: 4890-4913
Classification Level Classification E-value
Superfamily DPY module 0.0000458
Family DPY module 0.0015
Further Details:      
 
Domain Number 51 Region: 5421-5444
Classification Level Classification E-value
Superfamily DPY module 0.0000458
Family DPY module 0.0017
Further Details:      
 
Domain Number 52 Region: 13518-13541
Classification Level Classification E-value
Superfamily DPY module 0.0000484
Family DPY module 0.0016
Further Details:      
 
Domain Number 53 Region: 14390-14413
Classification Level Classification E-value
Superfamily DPY module 0.0000484
Family DPY module 0.0018
Further Details:      
 
Domain Number 54 Region: 15386-15409
Classification Level Classification E-value
Superfamily DPY module 0.0000484
Family DPY module 0.0014
Further Details:      
 
Domain Number 55 Region: 16366-16389
Classification Level Classification E-value
Superfamily DPY module 0.0000536
Family DPY module 0.0011
Further Details:      
 
Domain Number 56 Region: 915-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000543
Family EGF-type module 0.017
Further Details:      
 
Domain Number 57 Region: 7459-7482
Classification Level Classification E-value
Superfamily DPY module 0.0000562
Family DPY module 0.0012
Further Details:      
 
Domain Number 58 Region: 10221-10244
Classification Level Classification E-value
Superfamily DPY module 0.0000562
Family DPY module 0.0014
Further Details:      
 
Domain Number 59 Region: 7881-7904
Classification Level Classification E-value
Superfamily DPY module 0.0000575
Family DPY module 0.0013
Further Details:      
 
Domain Number 60 Region: 12345-12368
Classification Level Classification E-value
Superfamily DPY module 0.0000654
Family DPY module 0.001
Further Details:      
 
Domain Number 61 Region: 2746-2790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000691
Family EGF-type module 0.025
Further Details:      
 
Domain Number 62 Region: 12451-12474
Classification Level Classification E-value
Superfamily DPY module 0.0000772
Family DPY module 0.0015
Further Details:      
 
Domain Number 63 Region: 5318-5341
Classification Level Classification E-value
Superfamily DPY module 0.000085
Family DPY module 0.0014
Further Details:      
 
Domain Number 64 Region: 8737-8760
Classification Level Classification E-value
Superfamily DPY module 0.0000902
Family DPY module 0.0017
Further Details:      
 
Domain Number 65 Region: 8842-8865
Classification Level Classification E-value
Superfamily DPY module 0.0000902
Family DPY module 0.0016
Further Details:      
 
Domain Number 66 Region: 12665-12688
Classification Level Classification E-value
Superfamily DPY module 0.0000902
Family DPY module 0.0021
Further Details:      
 
Weak hits

Sequence:  FBpp0304624
Domain Number - Region: 5740-5763
Classification Level Classification E-value
Superfamily DPY module 0.000105
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 13107-13261
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000107
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number - Region: 8306-8329
Classification Level Classification E-value
Superfamily DPY module 0.00011
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 11812-11835
Classification Level Classification E-value
Superfamily DPY module 0.000115
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 11173-11196
Classification Level Classification E-value
Superfamily DPY module 0.000118
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 13410-13433
Classification Level Classification E-value
Superfamily DPY module 0.000122
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 10854-10877
Classification Level Classification E-value
Superfamily DPY module 0.000124
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 8098-8121
Classification Level Classification E-value
Superfamily DPY module 0.000126
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 6176-6199
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 16564-16586
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 1334-1479
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000157
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 4996-5018
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 6709-6732
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 6925-6948
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 11285-11308
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 5102-5125
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 9901-9924
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 13305-13328
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 11398-11550
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000188
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number - Region: 9158-9181
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 10117-10140
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 16472-16494
Classification Level Classification E-value
Superfamily DPY module 0.000248
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 8519-8542
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 2342-2501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000267
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 7778-7801
Classification Level Classification E-value
Superfamily DPY module 0.000275
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 8204-8227
Classification Level Classification E-value
Superfamily DPY module 0.000275
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 9583-9606
Classification Level Classification E-value
Superfamily DPY module 0.000301
Family DPY module 0.0011
Further Details:      
 
Domain Number - Region: 5850-5873
Classification Level Classification E-value
Superfamily DPY module 0.000314
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 12771-12794
Classification Level Classification E-value
Superfamily DPY module 0.000314
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 13090-13113
Classification Level Classification E-value
Superfamily DPY module 0.000314
Family DPY module 0.0026
Further Details:      
 
Domain Number - Region: 14054-14077
Classification Level Classification E-value
Superfamily DPY module 0.000327
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 6817-6840
Classification Level Classification E-value
Superfamily DPY module 0.00034
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 10610-10709
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000392
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 8944-8967
Classification Level Classification E-value
Superfamily DPY module 0.000484
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 8412-8435
Classification Level Classification E-value
Superfamily DPY module 0.000602
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 6939-7088
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000628
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 6066-6089
Classification Level Classification E-value
Superfamily DPY module 0.000667
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 12560-12583
Classification Level Classification E-value
Superfamily DPY module 0.000667
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 7572-7727
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000722
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 13372-13405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000737
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 15516-15671
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00104
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number - Region: 7349-7372
Classification Level Classification E-value
Superfamily DPY module 0.00109
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 6779-6812
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00128
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 10442-10595
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00138
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 11886-11982
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00144
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 7987-8010
Classification Level Classification E-value
Superfamily DPY module 0.00144
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 10751-10774
Classification Level Classification E-value
Superfamily DPY module 0.00144
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 17011-17034
Classification Level Classification E-value
Superfamily DPY module 0.0017
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 13584-13618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00183
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 17141-17164
Classification Level Classification E-value
Superfamily DPY module 0.00183
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 16165-16314
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00188
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 10970-11126
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00188
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 14124-14158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00188
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 5487-5521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.002
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 12734-12766
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0022
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 4782-4805
Classification Level Classification E-value
Superfamily DPY module 0.00235
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 13480-13513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00236
Family Merozoite surface protein 1 (MSP-1) 0.061
Further Details:      
 
Domain Number - Region: 7741-7773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0028
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 12131-12154
Classification Level Classification E-value
Superfamily DPY module 0.00288
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 16630-16653
Classification Level Classification E-value
Superfamily DPY module 0.00288
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 13636-13793
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0033
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 5278-5311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0037
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 15469-15502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00432
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 2632-2795
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00439
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number - Region: 11600-11623
Classification Level Classification E-value
Superfamily DPY module 0.0051
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 15790-15823
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00543
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 11618-11765
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00549
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number - Region: 16752-16775
Classification Level Classification E-value
Superfamily DPY module 0.00615
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 14015-14049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00711
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 13053-13085
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00712
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 5748-5908
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00863
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 10229-10384
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00879
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 4462-4498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00962
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 16110-16143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0111
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 7133-7156
Classification Level Classification E-value
Superfamily DPY module 0.0112
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 14247-14279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0119
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 17787-17809
Classification Level Classification E-value
Superfamily DPY module 0.0124
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 4681-4702
Classification Level Classification E-value
Superfamily DPY module 0.0144
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 12840-12873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0151
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 6617-6768
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0157
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 16148-16171
Classification Level Classification E-value
Superfamily DPY module 0.017
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 7202-7235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0181
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 15240-15274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0195
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 9167-9327
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0204
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 1849-1885
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0215
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 11250-11346
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0235
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number - Region: 7264-7407
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0259
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 8592-8690
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0267
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 8702-8799
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0282
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 10394-10427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0288
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 16433-16465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0292
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 9339-9434
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0298
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 790-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0321
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 4743-4776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 15685-15715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0341
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 7096-7128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0345
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 7424-7454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0352
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 12144-12297
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0377
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 5702-5735
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0405
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 9546-9578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0406
Family EGF-like domain of nidogen-1 0.051
Further Details:      
 
Domain Number - Region: 7843-7875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 8268-8301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 16952-16973
Classification Level Classification E-value
Superfamily DPY module 0.0445
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 11563-11595
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0463
Family EGF-type module 0.057
Further Details:      
 
Domain Number - Region: 4594-4627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0483
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 18040-18062
Classification Level Classification E-value
Superfamily DPY module 0.0484
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 16326-16354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0509
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 14352-14385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0514
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 17978-17998
Classification Level Classification E-value
Superfamily DPY module 0.0523
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 10924-10957
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0531
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 8905-8939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0585
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 4312-4471
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0596
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number - Region: 9121-9152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0636
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 17861-17881
Classification Level Classification E-value
Superfamily DPY module 0.0654
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 6886-6919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0681
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 5005-5161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0753
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 17304-17347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0765
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 6562-6595
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0779
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 17534-17556
Classification Level Classification E-value
Superfamily DPY module 0.0876
Family DPY module 0.0027
Further Details:      
 
Domain Number - Region: 2498-2519
Classification Level Classification E-value
Superfamily DPY module 0.0889
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 16694-16714
Classification Level Classification E-value
Superfamily DPY module 0.0994
Family DPY module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304624   Gene: FBgn0053196   Transcript: FBtr0332347
Sequence length 18641
Comment pep:known chromosome:BDGP5:2L:4479471:4591963:-1 gene:FBgn0053196 transcript:FBtr0332347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNE
STEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGY
GGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAAR
CVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP
DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD
ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGS
FQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQP
DGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFV
CTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACE
QVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNT
PGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAA
GCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKC
GAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPE
PNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAE
KAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCI
CRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEI
CNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSC
VDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAAN
EKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLL
GCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC
ASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGD
GALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVC
GIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPG
TFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK
PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQ
KGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICF
QLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEE
DKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNP
VVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCD
CLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAV
CVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEES
CGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKC
PPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVC
SCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNV
CVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCS
IDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAV
GERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIG
TPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCA
NNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHV
DCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQ
PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCE
RQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPC
SLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSP
LCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLS
DAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSN
DKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCG
PGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVC
AQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSV
CKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKE
CVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVC
LHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNP
TPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN
ECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCL
CPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRT
VCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVN
HGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKC
RNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTV
SEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCR
VVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAH
QGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRT
LGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTV
LHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCT
DPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMAC
SDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACR
KLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKEIGCASSDECPSQQA
CINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHGRTPGCEHCPPGANCDPTTGACIKA
NVTITTITTKNSTSTKIPTKPRTTANPNTGVKTTPTTTRVTTRNTTTTTTTTTTSSTSTE
SSTITSATNQTSKNQKPDTESTTSHTDATRRYRDGENNITDTPTPRPTIQTTTLRGEGVM
GDSQRRSTTTPKMKTTRLDTSNEVPDTTSPWPIELPTTEGTTTEVYNTMFAPVVNTTDTS
LINPCTVDTNCAPNEHCKLGHCRKKEPPGSPKTPEPCQSNNDCIESEACYMGLCQDPCEF
AKICAATAKCTAKSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQ
HPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDR
LNRRCINPCQEDSCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQA
CINGKCSSPCQCGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCE
LDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPP
SIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPC
GTGAICDSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYC
RSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGY
ECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALD
HPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINH
KCVDPCAGAICGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCG
PHDVCSVYGDGVALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGSCGR
NAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLA
CVCRKGYFGDPHIGCRPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCI
CAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPV
CQPECVVSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACS
PIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECP
SDKACINEKCQNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHID
PCYPNPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRD
PCTAACGANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRS
VEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNH
NPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFG
APPNCRPECVINQDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPY
TACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRPECVQNS
DCPNNRACINMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLP
LPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRC
KDPCPGTCGYNARCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSP
CGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGN
NALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAA
CKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCE
CLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIG
SPPNCRPECMSSSECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPF
VRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECT
SDSECPGNLACINLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVP
VQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNN
KCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPY
SQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAIC
KVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVC
SCLPNFVGRAPNCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCD
SGYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGC
RPECVVNSDCSRDKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACRE
IPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQ
NLNCQNQKCVDPCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSG
NPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNP
CIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAI
CRERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGACGINAECR
VLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEG
YIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTG
DPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNND
ECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTE
SPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACS
RFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPC
GPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHTCGIR
AICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVG
NSPACSCLPNFIGAPPRCRPECVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLP
ICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYE
GCRPECTLSADCPRDKACMRNRCVDPCPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNC
RVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSAL
QACVNKKCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPP
QDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSN
PCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIER
NGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNH
VPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFI
GAPPNCKPECTVNAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICSCPLDMTGDP
FARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPE
CVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVE
ETTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACL
NKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPN
SLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARC
QVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSC
AATFIGTPPSCRPECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVG
YTGDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRP
ECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEP
PQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTD
KACISQRCQDPCPGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVER
DPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRPECTISAECPSNLACIRERCIDP
CPGSCGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNA
QCNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGTCGENAICDVIN
HIPMCRCPERTAGSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSCLPSFIGAP
PSCRPECTSNSECAPTQACLNQRCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPFIR
CQPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECVTSSD
CSSQLACVNQKCVDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIR
TPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQD
PCPGTCGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQ
CRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADTCGNNAICR
VRNHSPICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPA
CSCLVNFIGQAPNCRPECTINSECPSQLACINQKCRDPCPGACGQNAVCSVINHTPLCAC
IDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCR
PECVLNTDCPRDRACVRNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGNAFFECRPV
PPAKIQNPCQPSPCGPNSQCRVVQQTAVCSCLANYVGSPPQCRPECVTNSDCPADQDCQN
MKCRDPCPGTCGFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCG
PNSECRVSGDSPSCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPCPGLCGQNA
ICRVFSHSAMCLCDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPCGVNAKCEERGGAGSCQ
CLPDYFGNPYDGCRPECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLATCNCL
VGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPAC
RPECTSSSECAADKACVNRKCVDPCPNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYR
QPPPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCRPECSINAECP
SHQACINQKCRDPCPGSCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPL
PPEDPCNPSPCGSNTQCNNGVCSCLPEYHGDPYTGCRPECVLHTDCDRSRACVRHKCVDP
CPGTCGTNAICEVLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRV
VNQQAICSCITSFIGSPPFCRPECTTNSECPLNLACRNQKCSDPCPGVCGRGAQCHVTNH
SPFCRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYI
GAPPNCRPECVTSSECPTNQACIQQKCRDPCPGLCGQSAECRVLSHTPSCVCPEGMEGDP
FTLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCRPECVLNS
DCPSNKACQQQKCQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVN
PCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPC
PNTCGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPY
SQCRSQGDAPACSCLVGYIGAPPNCRPECRINAECPSSQACINEKCRDPCPGSCGYGAIC
NVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIP
EYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGY
NGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSN
SECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQ
DIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQ
KCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGAN
AECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAE
CNVVNHTPMCNCFAGFIGDPYRYCSQPPEPIVHEYVNPCQPSPCGPNSNCREVNEQAVCS
CRSEFEGAPPNCRPQCTSSSECASNRACINQKCVDPCPGVCGQQAICEVRNHSPICRCPT
AMIGDPFVRCIPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGT
PPHCRPECSINAECPSHLACIGERCRDPCPGACGQQTECRVISHVPSCVCLRGYVGDAFL
ACHPAPPPPSREEPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACRPECVLSSECP
RNLACIQQKCTDPCPGTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPVQLDVYRNPCN
PSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQNQRCVDPCPGA
CGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRV
GETPSCSCLSNFFGTPPNCRPECVSNSECSQVHVCSNNRCKDPCPGLCGTDAVCRVISHS
AMCYCQPGYSGDPFVRCAPHIQRESIEIVQPCNPNPCGAFAECRQQNGVGSCQCLPEYFG
NPYEGCRPECVLDSDCPSQLACVNQKCRDPCPGSCGQNAECFVRNHLPTCNCLSGYVGDP
YRYCSIEPKPIREYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTPPGCRPECTVSSE
CNLDKACVRHKCLDPCPGACGSSANCQVVNHAPLCSCQAGYTGDPFTRCYPIPSPPTHIV
HDYARHPCQPSPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSECLSSLACINQ
RCADPCPGSCAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCNPSP
CGANAVCQNGQCSCIPEYQGDPYTGCRPECVLNADCPRNRACVRHKCVDPCPGTCAPNAI
CDVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPCYPSPCGPNSRCRVFNNNAVCSCI
EDFIGTPPNCRPECTHNSDCLPRLACQRQHCIDPCPGTCGFNALCHVVNHAPICSCPPKH
NGNPFLGCFPEPVRRDEVIPKNPCQPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNCRPE
CITNSECSFDKACLNQRCRDPCSGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPV
IQQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCRPECVTNNDCPSNKAC
QQQKCRDPCPGVCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPS
PCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCG
SNADCRVIQHAPICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDN
QGTATCSCLPSYFGTPPNCRPECTINPDCPSHLSCQQQRCRDPCPGACGFNALCTVINHN
PTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQCNCLPEFVGNP
LVGCRPECVLSTECDWSKACVRNKCIDPCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFS
QCRPLPPAPVRDVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGVPPSCRPECVSNAEC
PLHLACLQRHCRDPCPGVCGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPPIKHEP
IDPCQPSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRD
PCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCGANALCS
EGNGAGACKCLPEFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVR
DHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLP
NFIGSPPACRPECTISSECDLTLACVQQHCVDPCPGVCGNSAQCRVINHSPHCSCLPGFT
GDAISGCQRIPPAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAPPNC
RPECAINPDCASHLACISEKCRDPCPGSCGLQAQCSVINHTPICSCPSGYEGNPFVRCQR
TPPTPTPPLHDACNPSPCGSNAICSPGGQCSCLPDFDGNPYVGCRPECVLNTDCARDKAC
QRSKCTDPCPGACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTLVQSSPVVPLNPCQPSP
CGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQCRDPCPGACGQ
FAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCGPNAECTNQNE
QAICKCLKDYIGTPPNCRPECITSSECPIQLACIGQKCKDPCSGLCGIAATCQVVSHVPS
CICIADYIGDPYTGCYARPPIQREQINPCYQNPCGSNAVCRERGEAASCQCLPEYYGNPY
EGCRPECVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRH
CHVAQAEPVQVVHFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRPECTTNPEC
PNDKACVSRRCTDPCAGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDS
PVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRPECTQNSDCPSHRACVNQ
RCVDPCPGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQP
SPCGPNAQCSNGVCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSG
ATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVELHPCQPSPCGHHGECREVGSQAIC
TCRLGYYGSPPACRPECVSDPECPPSLACVNQKCRDPCPGACGHLAQCHVINHSPQCVCP
AGYTGSPYSECHLIRADSSPIQRQPIDPCLPSPCGPHAQCSNEGGNAVCRCLTEYLGVPP
YCRPECIANSECPSDRACINRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSC
LPPTRPEIPATPPTTAIQVLQYEEPFINGCEPNPCGANAQCNQRRGVVSCVCLPDYFGNP
YEACRPECILNSDCPLSRACVQQKCRDPCPGTCGLNAECHVMDHLPQCRCFSGYTGNPLA
YCSPVPIIQESPLTPCDPSPCGPNAQCHPSLNEAVCSCLPEFYGTPPNCRPECTLNSECA
YDKACVHHKCVDPCPGICGINADCRVHYHSPICYCISSHTGDPFTRCYETPKPVRPQIYD
TPSPPYPVAIPDLVYVQQQQPGIVNIPSAPQPIYPTPQSPQYNVNYPSPQPANPQKPGVV
NIPSVPQPVYPSPQPPVYDVNYPTTPVSQHPGVVNIPSAPRLVPPTSQRPVFITSPGNLS
PTPQPGVINIPSVSQPGYPTPQSPIYDANYPTTQSPIPQQPGVVNIPSVPSPSYPAPNPP
VNYPTQPSPQIPVQPGVINIPSAPLPTTPPQHPPVFIPSPESPSPAPKPGVINIPSVTHP
EYPTSQVPVYDVNYSTTPSPIPQKPGVVNIPSAPQPVHPAPNPPVHEFNYPTPPAVPQQP
GVLNIPSYPTPVAPTPQSPIYIPSQEQPKPTTRPSVINVPSVPQPAYPTPQAPVYDVNYP
TSPSVIPHQPGVVNIPSVPLPAPPVKQRPVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTY
QPPVVERPAIYDVYYPPPPSRPGVINIPSPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHN
IPSVPQPTYPHRNPPIQDVTYPAPQPSPPVPGIVNIPSLPQPVSTPTSGVINIPSQASPP
ISVPTPGIVNIPSIPQPTPQRPSPGIINVPSVPQPIPTAPSPGIINIPSVPQPLPSPTPG
VINIPQQPTPPPLVQQPGIINIPSVQQPSTPTTQHPIQDVQYETQRPQPTPGVINIPSVS
QPTYPTQKPSYQDTSYPTVQPKPPVSGIINIPSVPQPVPSLTPGVINLPSEPSYSAPIPK
PGIINVPSIPEPIPSIPQNPVQEVYHDTQKPQAIPGVVNVPSAPQPTPGRPYYDVAKPDF
EFNPCYPSPCGPYSHCHNRFGVAACVCLPNYRGTPPNCRPECVINSDCPSSLACINEKCR
DPCPGSCAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSIC
GPNAVCNNGKCSCIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPGTCGLQALC
HVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGP
NSQCRAYHEQAICYCLPNFIGTPPGCRPECTSNSDCPLDKYCLNLRCRDPCPGACGIRAI
CHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARC
SCLPQYHGTPPFCRPECVNSADCPADKACRNYKCIDPCPGSCGFSALCRVVAHSPVCYCP
EGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEIC
RPECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRI
PQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPAD
RACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIR
DPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDP
CPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANAL
CNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNH
IAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGY
FGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGN
AFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVS
HDECANTLACMNQKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEP
KPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQA
CIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSP
CGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGEC
GFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAAT
CSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQC
LRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEG
YTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLD
GYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFS
GNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRT
MMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQC
LAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPC
AGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQV
RCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCD
QETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINER
CADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNS
ECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPR
IPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQER
CLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNA
QFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGD
PFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPL
GNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTM
VCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQ
HRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQ
SNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRA
QNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPA
ICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRD
PCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQ
GEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCNDPCT
TTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECV
NPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDG
QCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLT
PRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCIT
GYTGNPDLHCNHTNFRTDFPRPDMVVSCLADGVQVEIHITEPGFNGVLYVKGHSKDEECR
RVVNLAGETVPRTEIFRVHFGSCGMQAVKDVASFVLVIQKHPKLVTYKAQAYNIKCVYQT
GEKNVTLGFNVSMLTTAGTIANTGPPPICQMRIITNEGEEINSAEIGDNLKLQVDVEPAT
IYGGFARSCIAKTMEDNVQNEYLVTDENGCATDTSIFGNWEYNPDTNSLLASFNAFKFPS
SDNIRFQCNIRVCFGRCQPVNCGGYNAFGRRRRSIADNSTDATAIATNSGVEGQLREEIT
ISSNAILTFEKRSGQGLNDANIKPAAQRVEDICVSMVGLIIALVITALLALVAVAVAVSC
WLMAYRRRPKTIAPLPHPPEFPNPLFSNPDAVPEPTPDYIS
Download sequence
Identical sequences M9PCJ6
FBpp0304624 NP_001260034.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]