SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304625 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304625
Domain Number 1 Region: 264-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000014
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 2 Region: 181-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000424
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 623-760
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000282
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 4 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000157
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 2389-2433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000186
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 6 Region: 492-625
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000534
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 2222-2259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000652
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 454-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000762
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 408-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000305
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 13453-13476
Classification Level Classification E-value
Superfamily DPY module 0.00000471
Family DPY module 0.00058
Further Details:      
 
Domain Number 11 Region: 19700-19723
Classification Level Classification E-value
Superfamily DPY module 0.00000523
Family DPY module 0.00085
Further Details:      
 
Domain Number 12 Region: 1429-1467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000567
Family EGF-type module 0.028
Further Details:      
 
Domain Number 13 Region: 9950-10104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000659
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 14 Region: 13347-13370
Classification Level Classification E-value
Superfamily DPY module 0.00000915
Family DPY module 0.00098
Further Details:      
 
Domain Number 15 Region: 16537-16560
Classification Level Classification E-value
Superfamily DPY module 0.00000915
Family DPY module 0.00093
Further Details:      
 
Domain Number 16 Region: 18938-18961
Classification Level Classification E-value
Superfamily DPY module 0.00000968
Family DPY module 0.00087
Further Details:      
 
Domain Number 17 Region: 13034-13057
Classification Level Classification E-value
Superfamily DPY module 0.0000119
Family DPY module 0.001
Further Details:      
 
Domain Number 18 Region: 826-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000149
Family EGF-type module 0.012
Further Details:      
 
Domain Number 19 Region: 14621-14644
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.00091
Further Details:      
 
Domain Number 20 Region: 17944-17967
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.00095
Further Details:      
 
Domain Number 21 Region: 15049-15072
Classification Level Classification E-value
Superfamily DPY module 0.0000183
Family DPY module 0.0012
Further Details:      
 
Domain Number 22 Region: 19495-19655
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 23 Region: 14092-14115
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.00091
Further Details:      
 
Domain Number 24 Region: 14195-14218
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.0013
Further Details:      
 
Domain Number 25 Region: 15366-15389
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.00087
Further Details:      
 
Domain Number 26 Region: 16642-16665
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.00093
Further Details:      
 
Domain Number 27 Region: 10688-10711
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.0011
Further Details:      
 
Domain Number 28 Region: 14726-14749
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.00083
Further Details:      
 
Domain Number 29 Region: 13986-14009
Classification Level Classification E-value
Superfamily DPY module 0.0000235
Family DPY module 0.001
Further Details:      
 
Domain Number 30 Region: 17822-17845
Classification Level Classification E-value
Superfamily DPY module 0.0000248
Family DPY module 0.0011
Further Details:      
 
Domain Number 31 Region: 15897-15920
Classification Level Classification E-value
Superfamily DPY module 0.0000275
Family DPY module 0.0014
Further Details:      
 
Domain Number 32 Region: 13139-13162
Classification Level Classification E-value
Superfamily DPY module 0.0000301
Family DPY module 0.0013
Further Details:      
 
Domain Number 33 Region: 9834-9857
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.001
Further Details:      
 
Domain Number 34 Region: 10153-10176
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.0012
Further Details:      
 
Domain Number 35 Region: 10260-10283
Classification Level Classification E-value
Superfamily DPY module 0.000034
Family DPY module 0.0013
Further Details:      
 
Domain Number 36 Region: 13669-13692
Classification Level Classification E-value
Superfamily DPY module 0.0000353
Family DPY module 0.00093
Further Details:      
 
Domain Number 37 Region: 15686-15709
Classification Level Classification E-value
Superfamily DPY module 0.0000353
Family DPY module 0.0011
Further Details:      
 
Domain Number 38 Region: 17501-17524
Classification Level Classification E-value
Superfamily DPY module 0.0000366
Family DPY module 0.0011
Further Details:      
 
Domain Number 39 Region: 17608-17631
Classification Level Classification E-value
Superfamily DPY module 0.0000366
Family DPY module 0.0019
Further Details:      
 
Domain Number 40 Region: 17283-17306
Classification Level Classification E-value
Superfamily DPY module 0.0000379
Family DPY module 0.0011
Further Details:      
 
Domain Number 41 Region: 12923-12946
Classification Level Classification E-value
Superfamily DPY module 0.0000392
Family DPY module 0.0015
Further Details:      
 
Domain Number 42 Region: 19380-19403
Classification Level Classification E-value
Superfamily DPY module 0.0000432
Family DPY module 0.001
Further Details:      
 
Domain Number 43 Region: 12711-12734
Classification Level Classification E-value
Superfamily DPY module 0.0000471
Family DPY module 0.0014
Further Details:      
 
Domain Number 44 Region: 9518-9541
Classification Level Classification E-value
Superfamily DPY module 0.0000484
Family DPY module 0.0013
Further Details:      
 
Domain Number 45 Region: 9198-9221
Classification Level Classification E-value
Superfamily DPY module 0.0000562
Family DPY module 0.0015
Further Details:      
 
Domain Number 46 Region: 9729-9752
Classification Level Classification E-value
Superfamily DPY module 0.0000562
Family DPY module 0.0017
Further Details:      
 
Domain Number 47 Region: 17177-17200
Classification Level Classification E-value
Superfamily DPY module 0.0000589
Family DPY module 0.0016
Further Details:      
 
Domain Number 48 Region: 18049-18072
Classification Level Classification E-value
Superfamily DPY module 0.0000589
Family DPY module 0.0018
Further Details:      
 
Domain Number 49 Region: 19045-19068
Classification Level Classification E-value
Superfamily DPY module 0.0000602
Family DPY module 0.0014
Further Details:      
 
Domain Number 50 Region: 20025-20048
Classification Level Classification E-value
Superfamily DPY module 0.0000654
Family DPY module 0.0011
Further Details:      
 
Domain Number 51 Region: 11118-11141
Classification Level Classification E-value
Superfamily DPY module 0.0000693
Family DPY module 0.0012
Further Details:      
 
Domain Number 52 Region: 13880-13903
Classification Level Classification E-value
Superfamily DPY module 0.0000693
Family DPY module 0.0014
Further Details:      
 
Domain Number 53 Region: 11540-11563
Classification Level Classification E-value
Superfamily DPY module 0.0000706
Family DPY module 0.0013
Further Details:      
 
Domain Number 54 Region: 910-951
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000712
Family EGF-type module 0.021
Further Details:      
 
Domain Number 55 Region: 1017-1064
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000745
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 56 Region: 16004-16027
Classification Level Classification E-value
Superfamily DPY module 0.0000811
Family DPY module 0.001
Further Details:      
 
Domain Number 57 Region: 2746-2790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000839
Family EGF-type module 0.025
Further Details:      
 
Domain Number 58 Region: 16766-16920
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000091
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number 59 Region: 16110-16133
Classification Level Classification E-value
Superfamily DPY module 0.0000942
Family DPY module 0.0015
Further Details:      
 
Weak hits

Sequence:  FBpp0304625
Domain Number - Region: 9626-9649
Classification Level Classification E-value
Superfamily DPY module 0.000105
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 12501-12524
Classification Level Classification E-value
Superfamily DPY module 0.000111
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 16324-16347
Classification Level Classification E-value
Superfamily DPY module 0.000111
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 11965-11988
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 1141-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 12295-12457
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000137
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 14832-14855
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 15471-15494
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 17069-17092
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 11757-11780
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 14513-14536
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 11222-11245
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 20223-20245
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 11327-11350
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 15057-15210
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000196
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number - Region: 9304-9326
Classification Level Classification E-value
Superfamily DPY module 0.000196
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 10368-10391
Classification Level Classification E-value
Superfamily DPY module 0.000196
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 14944-14967
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 9410-9433
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 13560-13583
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 16964-16987
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 12817-12840
Classification Level Classification E-value
Superfamily DPY module 0.000248
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 13776-13799
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 20131-20153
Classification Level Classification E-value
Superfamily DPY module 0.000301
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 12178-12201
Classification Level Classification E-value
Superfamily DPY module 0.000314
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 11863-11886
Classification Level Classification E-value
Superfamily DPY module 0.000327
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 10598-10746
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00033
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 11437-11460
Classification Level Classification E-value
Superfamily DPY module 0.00034
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 13242-13265
Classification Level Classification E-value
Superfamily DPY module 0.000366
Family DPY module 0.0011
Further Details:      
 
Domain Number - Region: 16430-16453
Classification Level Classification E-value
Superfamily DPY module 0.000379
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 16749-16772
Classification Level Classification E-value
Superfamily DPY module 0.000379
Family DPY module 0.0026
Further Details:      
 
Domain Number - Region: 19914-19937
Classification Level Classification E-value
Superfamily DPY module 0.000379
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 14269-14368
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000408
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 10476-10499
Classification Level Classification E-value
Superfamily DPY module 0.000418
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 17031-17064
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000444
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 12603-12626
Classification Level Classification E-value
Superfamily DPY module 0.000589
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 17677-17770
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000722
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number - Region: 12071-12094
Classification Level Classification E-value
Superfamily DPY module 0.000732
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 19175-19330
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000738
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number - Region: 16219-16242
Classification Level Classification E-value
Superfamily DPY module 0.000824
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 2342-2501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00124
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 11008-11031
Classification Level Classification E-value
Superfamily DPY module 0.00131
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 15545-15641
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00157
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 11646-11669
Classification Level Classification E-value
Superfamily DPY module 0.0017
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 14410-14433
Classification Level Classification E-value
Superfamily DPY module 0.0017
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 14629-14785
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00188
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 20670-20693
Classification Level Classification E-value
Superfamily DPY module 0.00209
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 20800-20823
Classification Level Classification E-value
Superfamily DPY module 0.00222
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 17295-17452
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00235
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 9795-9829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00249
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 17243-17277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00264
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 17139-17172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00288
Family Merozoite surface protein 1 (MSP-1) 0.061
Further Details:      
 
Domain Number - Region: 9090-9113
Classification Level Classification E-value
Superfamily DPY module 0.00301
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 20289-20312
Classification Level Classification E-value
Superfamily DPY module 0.00353
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 11400-11432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00367
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 14158-14254
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00471
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 19822-19973
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00494
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 16393-16425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00542
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 19128-19161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0055
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 15259-15282
Classification Level Classification E-value
Superfamily DPY module 0.00615
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 9586-9619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00629
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 13888-14043
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00636
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 19449-19482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00686
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 2632-2795
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00738
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number - Region: 20411-20434
Classification Level Classification E-value
Superfamily DPY module 0.00745
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 15278-15424
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00753
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number - Region: 984-1028
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00873
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 11209-11386
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0118
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 8770-8806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0122
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 13355-13511
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0133
Family Growth factor receptor domain 0.0074
Further Details:      
 
Domain Number - Region: 19769-19802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.014
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 10792-10815
Classification Level Classification E-value
Superfamily DPY module 0.0144
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 12566-12598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0152
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 21446-21468
Classification Level Classification E-value
Superfamily DPY module 0.0157
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 16712-16744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0168
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 8989-9010
Classification Level Classification E-value
Superfamily DPY module 0.017
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 10329-10363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0176
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 19807-19830
Classification Level Classification E-value
Superfamily DPY module 0.0209
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 10861-10894
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0225
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 18899-18933
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0242
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 1395-1438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0246
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 790-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0254
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 12826-12986
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0298
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 17906-17938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0298
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 8634-8666
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0305
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 14909-15005
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.033
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number - Region: 11977-12129
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0345
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 10755-10787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0356
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 15803-15956
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0361
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 13309-13342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0376
Family EGF-type module 0.055
Further Details:      
 
Domain Number - Region: 9313-9469
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0377
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 20092-20124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0384
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 14053-14086
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 12249-12282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0406
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 19344-19374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0406
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 16499-16532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0447
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 13523-13619
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0455
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 9051-9084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0466
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 11927-11960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0508
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 10438-10471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0527
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 13205-13237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0531
Family EGF-like domain of nidogen-1 0.051
Further Details:      
 
Domain Number - Region: 20611-20632
Classification Level Classification E-value
Superfamily DPY module 0.0549
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 12998-13093
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0565
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 15222-15254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0569
Family EGF-type module 0.057
Further Details:      
 
Domain Number - Region: 8902-8935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0577
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 21699-21721
Classification Level Classification E-value
Superfamily DPY module 0.0602
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 18011-18044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0622
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 21637-21657
Classification Level Classification E-value
Superfamily DPY module 0.0641
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 19985-20013
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0652
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 14583-14616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0665
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 17783-17817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0753
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 21520-21540
Classification Level Classification E-value
Superfamily DPY module 0.0798
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 12780-12811
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0905
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 10221-10254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0928
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 20963-21006
Classification Level Classification E-value
Superfamily EGF/Laminin 0.097
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304625   Gene: FBgn0053196   Transcript: FBtr0332348
Sequence length 22300
Comment pep:known chromosome:BDGP5:2L:4477462:4591963:-1 gene:FBgn0053196 transcript:FBtr0332348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNE
STEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGY
GGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAAR
CVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP
DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD
ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGS
FQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQP
DGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFV
CTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACE
QVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNT
PGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAA
GCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKC
GAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPE
PNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAE
KAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCI
CRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEI
CNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSC
VDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAAN
EKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLL
GCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC
ASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGD
GALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVC
GIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPG
TFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK
PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQ
KGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICF
QLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEE
DKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNP
VVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCD
CLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAV
CVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEES
CGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKC
PPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVC
SCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNV
CVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCS
IDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAV
GERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIG
TPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCA
NNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHV
DCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQ
PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCE
RQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPC
SLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSP
LCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLS
DAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSN
DKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCG
PGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVC
AQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSV
CKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKE
CVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVC
LHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNP
TPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN
ECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCL
CPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRT
VCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVN
HGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKC
RNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTV
SEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCR
VVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAH
QGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRT
LGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTV
LHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCT
DPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMAC
SDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACR
KLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQ
AHQCGSSGKCIDPCLTSCAGGVKCVVSAHRVTICTCPATLTNNTDSNCTSTDITVGTTTQ
RIETTTDFINVKYTVMQLANQTEMRTRFTDIEAENETTGPYTTTTESYKTTKQLSSNPET
ETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSESTTREVYT
IKPFDRSTPTPVSPDTTVPSITFETTTNIPIGTTRGQVTEQTTSSPSEKRTTIRVEESTL
PSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNDPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTTPSESPETPT
TLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGG
QVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTES
TRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTSSPSEVRTTIR
VEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSA
SLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSE
SPETPTTLPSDFTIRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVP
IGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYS
DQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSE
VRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEA
STPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSAD
RTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLE
TTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDF
TTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQT
TSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRTYSDQTTESTRDVPT
TRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTL
PSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPT
LPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVPIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTECT
RDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRV
EESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSASL
ETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESP
ETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGS
TGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQT
TESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRT
TIGVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTP
SPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTS
PSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTT
NVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITR
PHSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSES
PETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQ
TTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVR
TTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTRDVPTTRPFEAST
PSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRT
TPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETT
TSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFIT
RPHSEKTTESTRDVPTTRPFEASTPSSASSGNNCSISYFRNHYKCSNRFNRSADRTTPSE
SPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPI
GSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEV
RTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEAS
TPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDR
TSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSET
TTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFI
TRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTT
SSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTT
QPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLP
SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLETAVP
PVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTT
LPSDFTTRPHSDQTTESTRDVPTTRPFESSTPRPVTLEIAVPPVTSETTTNVAIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTEST
RDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRV
EESTLPSRSTDRTPPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVT
LEIAVPPVTSETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSES
PETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTTNVPIGSTVTSETTTNVPIGSTG
GQVAGQTTAPPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTE
STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPSEVRTTI
RVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFETSTPSP
VSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDTTIPSE
IPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRDA
LETTVTSLITETTKTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERTMPSNISSTTTV
FNNSEPVSDNLPTTISITVTDSPTTVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCT
VQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTF
NNPCSRNEDCRVFNHQPLCSAEHGRTPGCEHCPPGANCDPTTGACIKANVTITTITTKNS
TSTKIPTKPRTTANPNTGVKTTPTTTRVTTRNTTTTTTTTTTSSTSTESSTITSATNQTS
KNQKPDTESTTSHTDATRRYRDGENNITDTPTPRPTIQTTTLRGEGVMGDSQRRSTTTPK
MKTTRLDTSNEVPDTTSPWPIELPTTEGTTTEVYNTMFAPVVNTTDTSLINPCTVDTNCA
PNEHCKLGHCRKKEPPGSPKTPEPCQSNNDCIESEACYMGLCQDPCEFAKICAATAKCTA
KSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQHPCDVHDPCATN
AVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQED
SCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQC
GAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPK
GLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCD
PSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHP
VCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGC
REPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSK
ACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSPC
GRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKCVDPCAGAICG
INAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGV
ALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNVYEHNPV
CACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKGYFGDPH
IGCRPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIA
CNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECA
PNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVP
KNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKACINEKCQN
PCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAV
CTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAEC
TVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVG
YFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEG
NPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVIN
QDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREINVPV
QVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNK
CRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYS
QCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICK
VTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCS
CLPNFVGRAPNCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDS
GYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCR
PECVVNSDCSRDKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREI
PQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQN
LNCQNQKCVDPCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGN
PCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPC
IGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAIC
RERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGACGINAECRV
LNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGY
IGAPPSCKPECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGD
PISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDE
CQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTES
PSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSR
FKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCG
PNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHTCGIRA
ICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGN
SPACSCLPNFIGAPPRCRPECVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPI
CNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEG
CRPECTLSADCPRDKACMRNRCVDPCPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCR
VKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQ
ACVNKKCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQ
DPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNP
CPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERN
GAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHV
PNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIG
APPNCKPECTVNAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICSCPLDMTGDPF
ARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPEC
VVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEE
TTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLN
KKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNS
LCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQ
VINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCA
ATFIGTPPSCRPECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGY
TGDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRPE
CVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPP
QLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTDK
ACISQRCQDPCPGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERD
PCLPSPCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRPECTISAECPSNLACIRERCIDPC
PGSCGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNAQ
CNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGTCGENAICDVINH
IPMCRCPERTAGSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSCLPSFIGAPP
SCRPECTSNSECAPTQACLNQRCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPFIRC
QPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECVTSSDC
SSQLACVNQKCVDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRT
PCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQDP
CPGTCGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQC
RVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADTCGNNAICRV
RNHSPICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPAC
SCLVNFIGQAPNCRPECTINSECPSQLACINQKCRDPCPGACGQNAVCSVINHTPLCACI
DGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRP
ECVLNTDCPRDRACVRNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGNAFFECRPVP
PAKIQNPCQPSPCGPNSQCRVVQQTAVCSCLANYVGSPPQCRPECVTNSDCPADQDCQNM
KCRDPCPGTCGFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGP
NSECRVSGDSPSCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPCPGLCGQNAI
CRVFSHSAMCLCDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPCGVNAKCEERGGAGSCQC
LPDYFGNPYDGCRPECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLATCNCLV
GYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACR
PECTSSSECAADKACVNRKCVDPCPNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQ
PPPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCRPECSINAECPS
HQACINQKCRDPCPGSCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLP
PEDPCNPSPCGSNTQCNNGVCSCLPEYHGDPYTGCRPECVLHTDCDRSRACVRHKCVDPC
PGTCGTNAICEVLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRVV
NQQAICSCITSFIGSPPFCRPECTTNSECPLNLACRNQKCSDPCPGVCGRGAQCHVTNHS
PFCRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIG
APPNCRPECVTSSECPTNQACIQQKCRDPCPGLCGQSAECRVLSHTPSCVCPEGMEGDPF
TLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCRPECVLNSD
CPSNKACQQQKCQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNP
CQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCP
NTCGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYS
QCRSQGDAPACSCLVGYIGAPPNCRPECRINAECPSSQACINEKCRDPCPGSCGYGAICN
VINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPE
YHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYN
GNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNS
ECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQD
IVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQK
CRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANA
ECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAEC
NVVNHTPMCNCFAGFIGDPYRYCSQPPEPIVHEYVNPCQPSPCGPNSNCREVNEQAVCSC
RSEFEGAPPNCRPQCTSSSECASNRACINQKCVDPCPGVCGQQAICEVRNHSPICRCPTA
MIGDPFVRCIPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGTP
PHCRPECSINAECPSHLACIGERCRDPCPGACGQQTECRVISHVPSCVCLRGYVGDAFLA
CHPAPPPPSREEPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACRPECVLSSECPR
NLACIQQKCTDPCPGTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPVQLDVYRNPCNP
SPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQNQRCVDPCPGAC
GAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVG
ETPSCSCLSNFFGTPPNCRPECVSNSECSQVHVCSNNRCKDPCPGLCGTDAVCRVISHSA
MCYCQPGYSGDPFVRCAPHIQRESIEIVQPCNPNPCGAFAECRQQNGVGSCQCLPEYFGN
PYEGCRPECVLDSDCPSQLACVNQKCRDPCPGSCGQNAECFVRNHLPTCNCLSGYVGDPY
RYCSIEPKPIREYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTPPGCRPECTVSSEC
NLDKACVRHKCLDPCPGACGSSANCQVVNHAPLCSCQAGYTGDPFTRCYPIPSPPTHIVH
DYARHPCQPSPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSECLSSLACINQR
CADPCPGSCAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCNPSPC
GANAVCQNGQCSCIPEYQGDPYTGCRPECVLNADCPRNRACVRHKCVDPCPGTCAPNAIC
DVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPCYPSPCGPNSRCRVFNNNAVCSCIE
DFIGTPPNCRPECTHNSDCLPRLACQRQHCIDPCPGTCGFNALCHVVNHAPICSCPPKHN
GNPFLGCFPEPVRRDEVIPKNPCQPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNCRPEC
ITNSECSFDKACLNQRCRDPCSGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPVI
QQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCRPECVTNNDCPSNKACQ
QQKCRDPCPGVCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSP
CGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGS
NADCRVIQHAPICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDNQ
GTATCSCLPSYFGTPPNCRPECTINPDCPSHLSCQQQRCRDPCPGACGFNALCTVINHNP
TCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQCNCLPEFVGNPL
VGCRPECVLSTECDWSKACVRNKCIDPCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQ
CRPLPPAPVRDVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGVPPSCRPECVSNAECP
LHLACLQRHCRDPCPGVCGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPPIKHEPI
DPCQPSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRDP
CPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCGANALCSE
GNGAGACKCLPEFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVRD
HLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLPN
FIGSPPACRPECTISSECDLTLACVQQHCVDPCPGVCGNSAQCRVINHSPHCSCLPGFTG
DAISGCQRIPPAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAPPNCR
PECAINPDCASHLACISEKCRDPCPGSCGLQAQCSVINHTPICSCPSGYEGNPFVRCQRT
PPTPTPPLHDACNPSPCGSNAICSPGGQCSCLPDFDGNPYVGCRPECVLNTDCARDKACQ
RSKCTDPCPGACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTLVQSSPVVPLNPCQPSPC
GNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQCRDPCPGACGQF
AQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCGPNAECTNQNEQ
AICKCLKDYIGTPPNCRPECITSSECPIQLACIGQKCKDPCSGLCGIAATCQVVSHVPSC
ICIADYIGDPYTGCYARPPIQREQINPCYQNPCGSNAVCRERGEAASCQCLPEYYGNPYE
GCRPECVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHC
HVAQAEPVQVVHFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRPECTTNPECP
NDKACVSRRCTDPCAGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSP
VIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRPECTQNSDCPSHRACVNQR
CVDPCPGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPS
PCGPNAQCSNGVCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSGA
TCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVELHPCQPSPCGHHGECREVGSQAICT
CRLGYYGSPPACRPECVSDPECPPSLACVNQKCRDPCPGACGHLAQCHVINHSPQCVCPA
GYTGSPYSECHLIRADSSPIQRQPIDPCLPSPCGPHAQCSNEGGNAVCRCLTEYLGVPPY
CRPECIANSECPSDRACINRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCL
PPTRPEIPATPPTTAIQVLQYEEPFINGCEPNPCGANAQCNQRRGVVSCVCLPDYFGNPY
EACRPECILNSDCPLSRACVQQKCRDPCPGTCGLNAECHVMDHLPQCRCFSGYTGNPLAY
CSPVPIIQESPLTPCDPSPCGPNAQCHPSLNEAVCSCLPEFYGTPPNCRPECTLNSECAY
DKACVHHKCVDPCPGICGINADCRVHYHSPICYCISSHTGDPFTRCYETPKPVRPQIYDT
PSPPYPVAIPDLVYVQQQQPGIVNIPSAPQPIYPTPQSPQYNVNYPSPQPANPQKPGVVN
IPSVPQPVYPSPQPPVYDVNYPTTPVSQHPGVVNIPSAPRLVPPTSQRPVFITSPGNLSP
TPQPGVINIPSVSQPGYPTPQSPIYDANYPTTQSPIPQQPGVVNIPSVPSPSYPAPNPPV
NYPTQPSPQIPVQPGVINIPSAPLPTTPPQHPPVFIPSPESPSPAPKPGVINIPSVTHPE
YPTSQVPVYDVNYSTTPSPIPQKPGVVNIPSAPQPVHPAPNPPVHEFNYPTPPAVPQQPG
VLNIPSYPTPVAPTPQSPIYIPSQEQPKPTTRPSVINVPSVPQPAYPTPQAPVYDVNYPT
SPSVIPHQPGVVNIPSVPLPAPPVKQRPVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTYQ
PPVVERPAIYDVYYPPPPSRPGVINIPSPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHNI
PSVPQPTYPHRNPPIQDVTYPAPQPSPPVPGIVNIPSLPQPVSTPTSGVINIPSQASPPI
SVPTPGIVNIPSIPQPTPQRPSPGIINVPSVPQPIPTAPSPGIINIPSVPQPLPSPTPGV
INIPQQPTPPPLVQQPGIINIPSVQQPSTPTTQHPIQDVQYETQRPQPTPGVINIPSVSQ
PTYPTQKPSYQDTSYPTVQPKPPVSGIINIPSVPQPVPSLTPGVINLPSEPSYSAPIPKP
GIINVPSIPEPIPSIPQNPVQEVYHDTQKPQAIPGVVNVPSAPQPTPGRPYYDVAKPDFE
FNPCYPSPCGPYSHCHNRFGVAACVCLPNYRGTPPNCRPECVINSDCPSSLACINEKCRD
PCPGSCAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICG
PNAVCNNGKCSCIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPGTCGLQALCH
VYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGPN
SQCRAYHEQAICYCLPNFIGTPPGCRPECTSNSDCPLDKYCLNLRCRDPCPGACGIRAIC
HVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCS
CLPQYHGTPPFCRPECVNSADCPADKACRNYKCIDPCPGSCGFSALCRVVAHSPVCYCPE
GYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICR
PECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIP
QREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADR
ACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRD
PCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPC
PGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALC
NNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHI
AMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYF
GQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNA
FVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSH
DECANTLACMNQKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPK
PPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQAC
IRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPC
GPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGECG
FGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATC
SYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCL
RQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGY
TGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDG
YRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSG
NPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTM
MCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCL
AQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCA
GNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVR
CGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQ
ETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERC
ADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSE
CANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRI
PNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERC
LPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQ
FGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDP
FVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLG
NPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMV
CECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQH
RAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQS
NRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQ
NHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAI
CEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDP
CNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQG
EQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCNDPCTT
TALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVN
PCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQ
CVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTP
RGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITG
YTGNPDLHCNHTNFRTDFPRPDMVVSCLADGVQVEIHITEPGFNGVLYVKGHSKDEECRR
VVNLAGETVPRTEIFRVHFGSCGMQAVKDVASFVLVIQKHPKLVTYKAQAYNIKCVYQTG
EKNVTLGFNVSMLTTAGTIANTGPPPICQMRIITNEGEEINSAEIGDNLKLQVDVEPATI
YGGFARSCIAKTMEDNVQNEYLVTDENGCATDTSIFGNWEYNPDTNSLLASFNAFKFPSS
DNIRFQCNIRVCFGRCQPVNCGGYNAFGRRRRSIADNSTDATAIATNSGVEGQLREEITI
SSNAILTFEKRSGQGLNDANIKPAAQRVEDICVSMVGLIIALVITALLALVAVAVAVSCW
LMAYRRRPKTIAPLPHPPEFPNPLFSNPDAVPEPTPDYIS
Download sequence
Identical sequences M9PC45
FBpp0304625 NP_001260035.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]