SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304626 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304626
Domain Number 1 Region: 264-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000137
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 2 Region: 181-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000408
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 623-760
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000455
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 4 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000153
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 2389-2433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000186
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 6 Region: 492-625
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000487
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 2221-2259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000551
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 454-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000728
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 408-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000028
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 12810-12833
Classification Level Classification E-value
Superfamily DPY module 0.00000458
Family DPY module 0.00058
Further Details:      
 
Domain Number 11 Region: 19057-19080
Classification Level Classification E-value
Superfamily DPY module 0.0000051
Family DPY module 0.00085
Further Details:      
 
Domain Number 12 Region: 1429-1467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000577
Family EGF-type module 0.028
Further Details:      
 
Domain Number 13 Region: 15894-15917
Classification Level Classification E-value
Superfamily DPY module 0.00000876
Family DPY module 0.00093
Further Details:      
 
Domain Number 14 Region: 12704-12727
Classification Level Classification E-value
Superfamily DPY module 0.00000889
Family DPY module 0.00098
Further Details:      
 
Domain Number 15 Region: 18295-18318
Classification Level Classification E-value
Superfamily DPY module 0.00000929
Family DPY module 0.00087
Further Details:      
 
Domain Number 16 Region: 958-1070
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000102
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 17 Region: 12391-12414
Classification Level Classification E-value
Superfamily DPY module 0.0000115
Family DPY module 0.001
Further Details:      
 
Domain Number 18 Region: 13978-14001
Classification Level Classification E-value
Superfamily DPY module 0.0000144
Family DPY module 0.00091
Further Details:      
 
Domain Number 19 Region: 17301-17324
Classification Level Classification E-value
Superfamily DPY module 0.0000144
Family DPY module 0.00095
Further Details:      
 
Domain Number 20 Region: 826-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000178
Family EGF-type module 0.012
Further Details:      
 
Domain Number 21 Region: 14406-14429
Classification Level Classification E-value
Superfamily DPY module 0.0000183
Family DPY module 0.0012
Further Details:      
 
Domain Number 22 Region: 14723-14746
Classification Level Classification E-value
Superfamily DPY module 0.0000183
Family DPY module 0.00087
Further Details:      
 
Domain Number 23 Region: 13449-13472
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.00091
Further Details:      
 
Domain Number 24 Region: 13552-13575
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.0013
Further Details:      
 
Domain Number 25 Region: 15999-16022
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.00093
Further Details:      
 
Domain Number 26 Region: 18852-19012
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000204
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 27 Region: 10045-10068
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.0011
Further Details:      
 
Domain Number 28 Region: 14083-14106
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.00083
Further Details:      
 
Domain Number 29 Region: 13343-13366
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.001
Further Details:      
 
Domain Number 30 Region: 17179-17202
Classification Level Classification E-value
Superfamily DPY module 0.0000235
Family DPY module 0.0011
Further Details:      
 
Domain Number 31 Region: 15254-15277
Classification Level Classification E-value
Superfamily DPY module 0.0000275
Family DPY module 0.0014
Further Details:      
 
Domain Number 32 Region: 9834-9857
Classification Level Classification E-value
Superfamily DPY module 0.0000301
Family DPY module 0.001
Further Details:      
 
Domain Number 33 Region: 12496-12519
Classification Level Classification E-value
Superfamily DPY module 0.0000301
Family DPY module 0.0013
Further Details:      
 
Domain Number 34 Region: 13026-13049
Classification Level Classification E-value
Superfamily DPY module 0.000034
Family DPY module 0.00093
Further Details:      
 
Domain Number 35 Region: 15043-15066
Classification Level Classification E-value
Superfamily DPY module 0.000034
Family DPY module 0.0011
Further Details:      
 
Domain Number 36 Region: 16858-16881
Classification Level Classification E-value
Superfamily DPY module 0.0000353
Family DPY module 0.0011
Further Details:      
 
Domain Number 37 Region: 16965-16988
Classification Level Classification E-value
Superfamily DPY module 0.0000353
Family DPY module 0.0019
Further Details:      
 
Domain Number 38 Region: 16640-16663
Classification Level Classification E-value
Superfamily DPY module 0.0000366
Family DPY module 0.0011
Further Details:      
 
Domain Number 39 Region: 11644-11667
Classification Level Classification E-value
Superfamily DPY module 0.0000379
Family DPY module 0.0013
Further Details:      
 
Domain Number 40 Region: 12280-12303
Classification Level Classification E-value
Superfamily DPY module 0.0000379
Family DPY module 0.0015
Further Details:      
 
Domain Number 41 Region: 18737-18760
Classification Level Classification E-value
Superfamily DPY module 0.0000418
Family DPY module 0.001
Further Details:      
 
Domain Number 42 Region: 12068-12091
Classification Level Classification E-value
Superfamily DPY module 0.0000458
Family DPY module 0.0014
Further Details:      
 
Domain Number 43 Region: 9518-9541
Classification Level Classification E-value
Superfamily DPY module 0.0000471
Family DPY module 0.0013
Further Details:      
 
Domain Number 44 Region: 9198-9221
Classification Level Classification E-value
Superfamily DPY module 0.0000549
Family DPY module 0.0015
Further Details:      
 
Domain Number 45 Region: 9729-9752
Classification Level Classification E-value
Superfamily DPY module 0.0000549
Family DPY module 0.0017
Further Details:      
 
Domain Number 46 Region: 17406-17429
Classification Level Classification E-value
Superfamily DPY module 0.0000562
Family DPY module 0.0018
Further Details:      
 
Domain Number 47 Region: 16534-16557
Classification Level Classification E-value
Superfamily DPY module 0.0000575
Family DPY module 0.0016
Further Details:      
 
Domain Number 48 Region: 18402-18425
Classification Level Classification E-value
Superfamily DPY module 0.0000575
Family DPY module 0.0014
Further Details:      
 
Domain Number 49 Region: 19382-19405
Classification Level Classification E-value
Superfamily DPY module 0.0000628
Family DPY module 0.0011
Further Details:      
 
Domain Number 50 Region: 10475-10498
Classification Level Classification E-value
Superfamily DPY module 0.0000667
Family DPY module 0.0012
Further Details:      
 
Domain Number 51 Region: 13237-13260
Classification Level Classification E-value
Superfamily DPY module 0.0000667
Family DPY module 0.0014
Further Details:      
 
Domain Number 52 Region: 10897-10920
Classification Level Classification E-value
Superfamily DPY module 0.000068
Family DPY module 0.0013
Further Details:      
 
Domain Number 53 Region: 15361-15384
Classification Level Classification E-value
Superfamily DPY module 0.0000785
Family DPY module 0.001
Further Details:      
 
Domain Number 54 Region: 2746-2790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000813
Family EGF-type module 0.025
Further Details:      
 
Domain Number 55 Region: 15467-15490
Classification Level Classification E-value
Superfamily DPY module 0.0000915
Family DPY module 0.0015
Further Details:      
 
Weak hits

Sequence:  FBpp0304626
Domain Number - Region: 9626-9649
Classification Level Classification E-value
Superfamily DPY module 0.000101
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 11753-11776
Classification Level Classification E-value
Superfamily DPY module 0.000107
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 11858-11881
Classification Level Classification E-value
Superfamily DPY module 0.000107
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 15681-15704
Classification Level Classification E-value
Superfamily DPY module 0.000107
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 16123-16277
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000116
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number - Region: 11322-11345
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 14828-14851
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 1141-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 1334-1479
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00014
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 11114-11137
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 13870-13893
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 14189-14212
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 16426-16449
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 10579-10602
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 19580-19602
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 9304-9326
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 10684-10707
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 9410-9433
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 14301-14324
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 12917-12940
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 16321-16344
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 12174-12197
Classification Level Classification E-value
Superfamily DPY module 0.000248
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 13133-13156
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 19488-19510
Classification Level Classification E-value
Superfamily DPY module 0.000288
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 11535-11558
Classification Level Classification E-value
Superfamily DPY module 0.000301
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 11220-11243
Classification Level Classification E-value
Superfamily DPY module 0.000314
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 10794-10817
Classification Level Classification E-value
Superfamily DPY module 0.000327
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 910-951
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000349
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 12599-12622
Classification Level Classification E-value
Superfamily DPY module 0.000366
Family DPY module 0.0011
Further Details:      
 
Domain Number - Region: 15787-15810
Classification Level Classification E-value
Superfamily DPY module 0.000366
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 16106-16129
Classification Level Classification E-value
Superfamily DPY module 0.000366
Family DPY module 0.0026
Further Details:      
 
Domain Number - Region: 13626-13724
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000518
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 11960-11983
Classification Level Classification E-value
Superfamily DPY module 0.000575
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 17034-17127
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000612
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number - Region: 11428-11451
Classification Level Classification E-value
Superfamily DPY module 0.000706
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 9955-10103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000769
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 15576-15599
Classification Level Classification E-value
Superfamily DPY module 0.000798
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 16388-16421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000854
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 18532-18687
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000879
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number - Region: 14415-14566
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000989
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number - Region: 10365-10388
Classification Level Classification E-value
Superfamily DPY module 0.00128
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 2342-2501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00129
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 14901-14998
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00154
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 11003-11026
Classification Level Classification E-value
Superfamily DPY module 0.0017
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 13767-13790
Classification Level Classification E-value
Superfamily DPY module 0.0017
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 20027-20050
Classification Level Classification E-value
Superfamily DPY module 0.00196
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 19181-19330
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00204
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 13986-14142
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00204
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 20157-20180
Classification Level Classification E-value
Superfamily DPY module 0.00222
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 17140-17174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00228
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 9795-9829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00241
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 10647-10679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00254
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 16600-16634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00255
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 16652-16809
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00282
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 16496-16529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00288
Family Merozoite surface protein 1 (MSP-1) 0.061
Further Details:      
 
Domain Number - Region: 9090-9113
Classification Level Classification E-value
Superfamily DPY module 0.00288
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 19646-19669
Classification Level Classification E-value
Superfamily DPY module 0.0034
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 10757-10789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00341
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 876-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00407
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 9586-9619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00432
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 18485-18518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00524
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 15750-15782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00559
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 14526-14675
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00604
Family Growth factor receptor domain 0.0074
Further Details:      
 
Domain Number - Region: 13515-13611
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00628
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 18806-18839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00661
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 19768-19791
Classification Level Classification E-value
Superfamily DPY module 0.00732
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 9693-9724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00762
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 13786-13929
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0104
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 13245-13400
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0115
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 8770-8806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 10149-10172
Classification Level Classification E-value
Superfamily DPY module 0.0131
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 19126-19159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0135
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 16069-16101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0138
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 20803-20825
Classification Level Classification E-value
Superfamily DPY module 0.0144
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 8989-9010
Classification Level Classification E-value
Superfamily DPY module 0.017
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 15856-15889
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0185
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 19164-19187
Classification Level Classification E-value
Superfamily DPY module 0.0209
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 10218-10251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0219
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 18256-18290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0233
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 790-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0249
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 17263-17295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0288
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 11718-11815
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0298
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 14266-14362
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0314
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number - Region: 12183-12343
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0345
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 15160-15313
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0345
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 11608-11706
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0361
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 12355-12450
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0377
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 19449-19481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0381
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 18701-18731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0406
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 12880-12976
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0408
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 9051-9084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0435
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 9313-9469
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0455
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 12562-12594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0503
Family EGF-like domain of nidogen-1 0.051
Further Details:      
 
Domain Number - Region: 11284-11317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0508
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 19968-19989
Classification Level Classification E-value
Superfamily DPY module 0.0536
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 21056-21078
Classification Level Classification E-value
Superfamily DPY module 0.0575
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 8620-8779
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0581
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number - Region: 8902-8935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0603
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 19342-19370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0621
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 20994-21014
Classification Level Classification E-value
Superfamily DPY module 0.0628
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 11494-11529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0629
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 13940-13973
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0636
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 20877-20897
Classification Level Classification E-value
Superfamily DPY module 0.0772
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 1827-1946
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.08
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 17368-17401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 13410-13443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 9902-9935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0867
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 12137-12168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0872
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 11923-11955
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0938
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 20320-20363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.094
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304626   Gene: FBgn0053196   Transcript: FBtr0332349
Sequence length 21657
Comment pep:known chromosome:BDGP5:2L:4477462:4591963:-1 gene:FBgn0053196 transcript:FBtr0332349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNE
STEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGY
GGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAAR
CVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP
DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD
ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGS
FQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQP
DGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFV
CTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACE
QVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNT
PGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAA
GCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKC
GAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPE
PNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAE
KAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCI
CRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEI
CNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSC
VDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAAN
EKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLL
GCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC
ASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGD
GALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVC
GIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPG
TFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK
PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQ
KGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICF
QLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEE
DKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNP
VVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCD
CLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAV
CVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEES
CGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKC
PPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVC
SCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNV
CVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCS
IDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAV
GERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIG
TPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCA
NNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHV
DCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQ
PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCE
RQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPC
SLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSP
LCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLS
DAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSN
DKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCG
PGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVC
AQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSV
CKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKE
CVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVC
LHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNP
TPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN
ECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCL
CPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRT
VCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVN
HGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKC
RNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTV
SEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCR
VVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAH
QGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRT
LGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTV
LHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCT
DPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMAC
SDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACR
KLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQ
AHQCGSSGKCIDPCLTSCAGGVKCVVSAHRVTICTCPATLTNNTDSNCTSTDITVGTTTQ
RIETTTDFINVKYTVMQLANQTEMRTRFTDIEAENETTGPYTTTTESYKTTKQLSSNPET
ETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSESTTREVYT
IKPFDRSTPTPVSPDTTVPSITFETTTNIPIGTTRGQVTEQTTSSPSEKRTTIRVEESTL
PSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNDPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTTPSESPETPT
TLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGG
QVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTES
TRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTSSPSEVRTTIR
VEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSA
SLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSE
SPETPTTLPSDFTIRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVP
IGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYS
DQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSE
VRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEA
STPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSAD
RTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLE
TTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDF
TTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQT
TSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRTYSDQTTESTRDVPT
TRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTL
PSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPT
LPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVPIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTECT
RDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRV
EESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSASL
ETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESP
ETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGS
TGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQT
TESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRT
TIGVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTP
SPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTS
PSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTT
NVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITR
PHSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSES
PETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQ
TTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVR
TTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTRDVPTTRPFEAST
PSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRT
TPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETT
TSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFIT
RPHSEKTTESTRDVPTTRPFEASTPSSASSGNNCSISYFRNHYKCSNRFNRSADRTTPSE
SPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPI
GSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEV
RTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEAS
TPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDR
TSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSET
TTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFI
TRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTT
SSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTT
QPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLP
SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLETAVP
PVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTT
LPSDFTTRPHSDQTTESTRDVPTTRPFESSTPRPVTLEIAVPPVTSETTTNVAIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTEST
RDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRV
EESTLPSRSTDRTPPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVT
LEIAVPPVTSETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSES
PETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTTNVPIGSTVTSETTTNVPIGSTG
GQVAGQTTAPPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTE
STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPSEVRTTI
RVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFETSTPSP
VSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDTTIPSE
IPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRDA
LETTVTSLITETTKTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERTMPSNISSTTTV
FNNSEPVSDNLPTTISITVTDSPTTVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCT
VQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTF
NNPCSRNEDCRVFNHQPLCSAEHGRTPGCEHCPPGANCDPTTGACIKANVTITTITTKNS
TSTKIPTKPRTTANPNTGVKTTPTTTRVTTRNTTTTTTTTTTSSTSTESSTITSATNQTS
KNQKPDTESTTSHTDATRRYRDGENNITDTPTPRPTIQTTTLRGEGVMGDSQRRSTTTPK
MKTTRLDTSNEVPDTTSPWPIELPTTEGTTTEVYNTMFAPVVNTTDTSLINPCTVDTNCA
PNEHCKLGHCRKKEPPGSPKTPEPCQSNNDCIESEACYMGLCQDPCEFAKICAATAKCTA
KSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQHPCDVHDPCATN
AVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQED
SCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQC
GAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPK
GLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCD
PSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHP
VCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGC
REPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSK
ACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSPC
GRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKCVDPCAGAICG
INAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGV
ALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNVYEHNPV
CACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKGYFGDPH
IGCRPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIA
CNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECA
PNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVP
KNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKACINEKCQN
PCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAV
CTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAEC
TVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVG
YFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEG
NPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVIN
QDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIAPPD
ETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDRSRACINNK
CQDPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYS
QCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQ
VVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAG
YIGRPPTCRPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEG
EPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCR
RECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPV
PVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKAC
VHKKCVDPCQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPAS
CVPSPCGPNAKCQIVGNSPACSCLPNFIGAPPRCRPECVLNSECGPTEACINQKCADPCS
GSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCF
AGECRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCPGICGNNAVCEVMNHIP
VCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAP
PQCRPECVVSSECSALQACVNKKCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQ
CVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIIN
PDCQSTQACINNKCSNPCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPK
PCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDP
CPGICGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKC
RVANGLAVCSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCAKTCGLNAKCEVI
NHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASC
SCLPNFIGAPPNCRPECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCR
GGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQGDPYTGCR
PECTLSTDCAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHE
TPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNR
KCVDPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCG
PNSECKVLNGNAACSCAATFIGTPPSCRPECSINPECPPTKACIRQKCSDPCVNACGFNA
RCNVANHQPICTCDVGYTGDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGSC
QCLPDHFGDPYQSCRPECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTC
RIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLP
PNCRPECVLSTECPTDKACISQRCQDPCPGTCGINAECRVRNHSPLCQCRQGFTGDSFTR
CYPLPPPPPVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRPECTISA
ECPSNLACIRERCIDPCPGSCGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQ
SEYVDPCNPSPCGPNAQCNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVN
PCPGTCGENAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPCRPSPCGPNSQCREV
NQQAVCSCLPSFIGAPPSCRPECTSNSECAPTQACLNQRCGDPCPGTCGVGANCAVVSHS
PFCTCPERFTGNPFIRCQPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETY
IGRPPNCRPECVTSSDCSSQLACVNQKCVDPCPGRCGLNAECFVVSHAVQCICQQGFNGD
PFVQCKPEIAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPECMLD
SDCPSNRACQQLRCQDPCPGTCGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQN
EYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKC
VDPCAADTCGNNAICRVRNHSPICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPT
PCGPNSECRNINGVPACSCLVNFIGQAPNCRPECTINSECPSQLACINQKCRDPCPGACG
QNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQ
CSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPCSGTCGVNALCEVNNHIPICR
CPEQMSGNAFFECRPVPPAKIQNPCQPSPCGPNSQCRVVQQTAVCSCLANYVGSPPQCRP
ECVTNSDCPADQDCQNMKCRDPCPGTCGFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLI
IRDERPQNPCQPSPCGPNSECRVSGDSPSCSCLPEFVGAPPNCRPECISNSECPTNQACI
NQKCVDPCPGLCGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPC
GVNAKCEERGGAGSCQCLPDYFGNPYDGCRPECVLNSDCPSNQACVNQKCRDPCPGTCGQ
NAECQVVNHLATCNCLVGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQ
GVCSCLPEFIGSPPACRPECTSSSECAADKACVNRKCVDPCPNVCGQQAECRVRNHNPIC
TCLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLG
TPPNCRPECSINAECPSHQACINQKCRDPCPGSCGLNTQCSVINHTPICSCLAGYIGDPF
SVCNPEPIPEKIRDPLPPEDPCNPSPCGSNTQCNNGVCSCLPEYHGDPYTGCRPECVLHT
DCDRSRACVRHKCVDPCPGTCGTNAICEVLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQ
NPCQPSPCGPNSQCRVVNQQAICSCITSFIGSPPFCRPECTTNSECPLNLACRNQKCSDP
CPGVCGRGAQCHVTNHSPFCRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQC
REVNESPSCTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPGLCGQSAECRVL
SHTPSCVCPEGMEGDPFTLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGSCQCLPDY
FGNPYEGCRPECVLNSDCPSNKACQQQKCQDPCPGTCGQNALCNVLNHIPSCSCISGYSG
DPYRSCVPEPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSE
CPADKACVNQKCVDPCPNTCGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPV
QKTPVDPCVPTPCGPYSQCRSQGDAPACSCLVGYIGAPPNCRPECRINAECPSSQACINE
KCRDPCPGSCGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSP
CGPNAQCNNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAI
CTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVP
GYIGTPPLCRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFT
GNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPE
CVANSECPSNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQ
DVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQ
QKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPIVHEYVNPCQPSPC
GPNSNCREVNEQAVCSCRSEFEGAPPNCRPQCTSSSECASNRACINQKCVDPCPGVCGQQ
AICEVRNHSPICRCPTAMIGDPFVRCIPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRN
QQNQAVCSCLPNYFGTPPHCRPECSINAECPSHLACIGERCRDPCPGACGQQTECRVISH
VPSCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSNQGECKCVADYQGD
PYVACRPECVLSSECPRNLACIQQKCTDPCPGTCGTNAICDVVNHIAMCHCPDRMTGNAF
VQCTPVQLDVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSP
SLACQNQRCVDPCPGACGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQRDITPKD
PCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRPECVSNSECSQVHVCSNNRCKDPC
PGLCGTDAVCRVISHSAMCYCQPGYSGDPFVRCAPHIQRESIEIVQPCNPNPCGAFAECR
QQNGVGSCQCLPEYFGNPYEGCRPECVLDSDCPSQLACVNQKCRDPCPGSCGQNAECFVR
NHLPTCNCLSGYVGDPYRYCSIEPKPIREYVNPCQPSPCGPNSQCREQNGVATCSCLPEF
VGTPPGCRPECTVSSECNLDKACVRHKCLDPCPGACGSSANCQVVNHAPLCSCQAGYTGD
PFTRCYPIPSPPTHIVHDYARHPCQPSPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPE
CTQSSECLSSLACINQRCADPCPGSCAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQ
PPPKPVALDDPCNPSPCGANAVCQNGQCSCIPEYQGDPYTGCRPECVLNADCPRNRACVR
HKCVDPCPGTCAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPCYPSPCGP
NSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQRQHCIDPCPGTCGFNAL
CHVVNHAPICSCPPKHNGNPFLGCFPEPVRRDEVIPKNPCQPSPCGPYAKCTSVGDQAQC
SCLPEYIGTPPNCRPECITNSECSFDKACLNQRCRDPCSGTCGSNANCHVISHTAMCYCL
PGFTGDPFTSCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETC
RPECVTNNDCPSNKACQQQKCRDPCPGVCALNALCRVINHLPTCHCQNGFVGDPYRYCQI
PEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDK
ACIRQKCNDPCPGVCGSNADCRVIQHAPICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRN
PCVPSPCGQYAECRDNQGTATCSCLPSYFGTPPNCRPECTINPDCPSHLSCQQQRCRDPC
PGACGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAV
CNQGQCNCLPEFVGNPLVGCRPECVLSTECDWSKACVRNKCIDPCPGTCGSNAICEVHRH
IAMCHCPPEMTGNAFSQCRPLPPAPVRDVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFI
GVPPSCRPECVSNAECPLHLACLQRHCRDPCPGVCGLNAECRVINHSPNCHCIGSFTGNP
FAACHRPPPPPIKHEPIDPCQPSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSN
SDCPMNLACLNQKCRDPCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEP
QTPCVPSPCGANALCSEGNGAGACKCLPEFYGNPYEGCRPECVLNSDCPSHLACLNQHCR
DPCPGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPN
SQCRESNNQAICKCLPNFIGSPPACRPECTISSECDLTLACVQQHCVDPCPGVCGNSAQC
RVINHSPHCSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQ
AICSCLPGYYGAPPNCRPECAINPDCASHLACISEKCRDPCPGSCGLQAQCSVINHTPIC
SCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQCSCLPDFDGNPYVGC
RPECVLNTDCARDKACQRSKCTDPCPGACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTL
VQSSPVVPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINSDCAPHLA
CLNQQCRDPCPGACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPC
YPSPCGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLACIGQKCKDPCSG
LCGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPIQREQINPCYQNPCGSNAVCRERG
EAASCQCLPEYYGNPYEGCRPECVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHV
PSCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQPSPCGPNSQCTESQGQAVCRCLPDYY
GSPPACRPECTTNPECPNDKACVSRRCTDPCAGACGQNAICRAHQHRAYCSCHPGYTGDA
FMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRPE
CTQNSDCPSHRACVNQRCVDPCPGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPA
PPPTPVTVVADDPCQPSPCGPNAQCSNGVCSCLPLYQGDPYVGCRPECVLSTECPWDKAC
IRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVELHPCQPSP
CGHHGECREVGSQAICTCRLGYYGSPPACRPECVSDPECPPSLACVNQKCRDPCPGACGH
LAQCHVINHSPQCVCPAGYTGSPYSECHLIRADSSPIQRQPIDPCLPSPCGPHAQCSNEG
GNAVCRCLTEYLGVPPYCRPECIANSECPSDRACINRKCQDPCPGLCGYNAICRTYNHQP
NCVCAPGLVGNPFNSCLPPTRPEIPATPPTTAIQVLQYEEPFINGCEPNPCGANAQCNQR
RGVVSCVCLPDYFGNPYEACRPECILNSDCPLSRACVQQKCRDPCPGTCGLNAECHVMDH
LPQCRCFSGYTGNPLAYCSPVPIIQESPLTPCDPSPCGPNAQCHPSLNEAVCSCLPEFYG
TPPNCRPECTLNSECAYDKACVHHKCVDPCPGICGINADCRVHYHSPICYCISSHTGDPF
TRCYETPKPVRPQIYDTPSPPYPVAIPDLVYVQQQQPGIVNIPSAPQPIYPTPQSPQYNV
NYPSPQPANPQKPGVVNIPSVPQPVYPSPQPPVYDVNYPTTPVSQHPGVVNIPSAPRLVP
PTSQRPVFITSPGNLSPTPQPGVINIPSVSQPGYPTPQSPIYDANYPTTQSPIPQQPGVV
NIPSVPSPSYPAPNPPVNYPTQPSPQIPVQPGVINIPSAPLPTTPPQHPPVFIPSPESPS
PAPKPGVINIPSVTHPEYPTSQVPVYDVNYSTTPSPIPQKPGVVNIPSAPQPVHPAPNPP
VHEFNYPTPPAVPQQPGVLNIPSYPTPVAPTPQSPIYIPSQEQPKPTTRPSVINVPSVPQ
PAYPTPQAPVYDVNYPTSPSVIPHQPGVVNIPSVPLPAPPVKQRPVFVPSPVHPTPAPQP
GVVNIPSVAQPVHPTYQPPVVERPAIYDVYYPPPPSRPGVINIPSPPRPVYPVPQQPIYV
PAPVLHIPAPRPVIHNIPSVPQPTYPHRNPPIQDVTYPAPQPSPPVPGIVNIPSLPQPVS
TPTSGVINIPSQASPPISVPTPGIVNIPSIPQPTPQRPSPGIINVPSVPQPIPTAPSPGI
INIPSVPQPLPSPTPGVINIPQQPTPPPLVQQPGIINIPSVQQPSTPTTQHPIQDVQYET
QRPQPTPGVINIPSVSQPTYPTQKPSYQDTSYPTVQPKPPVSGIINIPSVPQPVPSLTPG
VINLPSEPSYSAPIPKPGIINVPSIPEPIPSIPQNPVQEVYHDTQKPQAIPGVVNVPSAP
QPTPGRPYYDVAKPDFEFNPCYPSPCGPYSHCHNRFGVAACVCLPNYRGTPPNCRPECVI
NSDCPSSLACINEKCRDPCPGSCAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPV
QREPIEAKDPCYPSICGPNAVCNNGKCSCIPEYRGDPYVGCRPECVLNTDCARDKACIQQ
KCKNPCPGTCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIV
PQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTPPGCRPECTSNSDCPLDKYCLN
LRCRDPCPGACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSP
CGPNSECQATSGGARCSCLPQYHGTPPFCRPECVNSADCPADKACRNYKCIDPCPGSCGF
SALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLS
VCQCLPGYYGNPSEICRPECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVINHSPVC
ECHTGHVGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTP
PSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTR
CLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINA
ECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPK
TPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDP
CPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQ
CLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQA
IQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCL
QEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGM
TGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEG
CRPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCT
RQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKD
RACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPS
PCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKA
VCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQA
RCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGA
ICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQC
RVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPC
GANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNC
VNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTA
CINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDK
TCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCAD
HEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQC
IQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNC
VPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQ
GNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQRK
AICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVK
NHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYG
RNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQ
ALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCH
PTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQC
RNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINP
CLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVN
PCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINE
QCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISD
SDCPTDKSCLNSVCRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDC
PGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDEC
PTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICIS
DADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDK
RSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVID
ERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVN
AFCNAVNHRAQCQCITGYTGNPDLHCNHTNFRTDFPRPDMVVSCLADGVQVEIHITEPGF
NGVLYVKGHSKDEECRRVVNLAGETVPRTEIFRVHFGSCGMQAVKDVASFVLVIQKHPKL
VTYKAQAYNIKCVYQTGEKNVTLGFNVSMLTTAGTIANTGPPPICQMRIITNEGEEINSA
EIGDNLKLQVDVEPATIYGGFARSCIAKTMEDNVQNEYLVTDENGCATDTSIFGNWEYNP
DTNSLLASFNAFKFPSSDNIRFQCNIRVCFGRCQPVNCGGYNAFGRRRRSIADNSTDATA
IATNSGVEGQLREEITISSNAILTFEKRSGQGLNDANIKPAAQRVEDICVSMVGLIIALV
ITALLALVAVAVAVSCWLMAYRRRPKTIAPLPHPPEFPNPLFSNPDAVPEPTPDYIS
Download sequence
Identical sequences M9PEI1
FBpp0304626 NP_001260036.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]