SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304627 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304627
Domain Number 1 Region: 210-340
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000675
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 2 Region: 129-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 12308-12472
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000282
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 11557-11580
Classification Level Classification E-value
Superfamily DPY module 0.00000418
Family DPY module 0.00058
Further Details:      
 
Domain Number 5 Region: 17804-17827
Classification Level Classification E-value
Superfamily DPY module 0.00000471
Family DPY module 0.00085
Further Details:      
 
Domain Number 6 Region: 7719-7742
Classification Level Classification E-value
Superfamily DPY module 0.00000745
Family DPY module 0.001
Further Details:      
 
Domain Number 7 Region: 11451-11474
Classification Level Classification E-value
Superfamily DPY module 0.00000824
Family DPY module 0.00098
Further Details:      
 
Domain Number 8 Region: 14641-14664
Classification Level Classification E-value
Superfamily DPY module 0.00000824
Family DPY module 0.00093
Further Details:      
 
Domain Number 9 Region: 17042-17065
Classification Level Classification E-value
Superfamily DPY module 0.00000876
Family DPY module 0.00087
Further Details:      
 
Domain Number 10 Region: 8054-8208
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00001
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 11 Region: 11138-11161
Classification Level Classification E-value
Superfamily DPY module 0.0000107
Family DPY module 0.001
Further Details:      
 
Domain Number 12 Region: 12725-12748
Classification Level Classification E-value
Superfamily DPY module 0.0000144
Family DPY module 0.00091
Further Details:      
 
Domain Number 13 Region: 16048-16071
Classification Level Classification E-value
Superfamily DPY module 0.0000144
Family DPY module 0.00095
Further Details:      
 
Domain Number 14 Region: 17599-17759
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000157
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 15 Region: 13153-13176
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.0012
Further Details:      
 
Domain Number 16 Region: 13470-13493
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.00087
Further Details:      
 
Domain Number 17 Region: 12196-12219
Classification Level Classification E-value
Superfamily DPY module 0.0000183
Family DPY module 0.00091
Further Details:      
 
Domain Number 18 Region: 14746-14769
Classification Level Classification E-value
Superfamily DPY module 0.0000183
Family DPY module 0.00093
Further Details:      
 
Domain Number 19 Region: 8792-8815
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.0011
Further Details:      
 
Domain Number 20 Region: 12830-12853
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.00083
Further Details:      
 
Domain Number 21 Region: 12090-12113
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.001
Further Details:      
 
Domain Number 22 Region: 15926-15949
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.0011
Further Details:      
 
Domain Number 23 Region: 14001-14024
Classification Level Classification E-value
Superfamily DPY module 0.0000248
Family DPY module 0.0014
Further Details:      
 
Domain Number 24 Region: 7396-7419
Classification Level Classification E-value
Superfamily DPY module 0.0000262
Family DPY module 0.00089
Further Details:      
 
Domain Number 25 Region: 11243-11266
Classification Level Classification E-value
Superfamily DPY module 0.0000275
Family DPY module 0.0013
Further Details:      
 
Domain Number 26 Region: 7289-7312
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.001
Further Details:      
 
Domain Number 27 Region: 8257-8280
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.0012
Further Details:      
 
Domain Number 28 Region: 8364-8387
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.0013
Further Details:      
 
Domain Number 29 Region: 11773-11796
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.00093
Further Details:      
 
Domain Number 30 Region: 13790-13813
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.0011
Further Details:      
 
Domain Number 31 Region: 15605-15628
Classification Level Classification E-value
Superfamily DPY module 0.0000327
Family DPY module 0.0011
Further Details:      
 
Domain Number 32 Region: 15712-15735
Classification Level Classification E-value
Superfamily DPY module 0.0000327
Family DPY module 0.0019
Further Details:      
 
Domain Number 33 Region: 10391-10414
Classification Level Classification E-value
Superfamily DPY module 0.0000353
Family DPY module 0.0013
Further Details:      
 
Domain Number 34 Region: 11027-11050
Classification Level Classification E-value
Superfamily DPY module 0.0000353
Family DPY module 0.0015
Further Details:      
 
Domain Number 35 Region: 15387-15410
Classification Level Classification E-value
Superfamily DPY module 0.0000353
Family DPY module 0.0011
Further Details:      
 
Domain Number 36 Region: 17484-17507
Classification Level Classification E-value
Superfamily DPY module 0.0000392
Family DPY module 0.001
Further Details:      
 
Domain Number 37 Region: 10815-10838
Classification Level Classification E-value
Superfamily DPY module 0.0000418
Family DPY module 0.0014
Further Details:      
 
Domain Number 38 Region: 6973-6996
Classification Level Classification E-value
Superfamily DPY module 0.0000432
Family DPY module 0.0013
Further Details:      
 
Domain Number 39 Region: 6653-6676
Classification Level Classification E-value
Superfamily DPY module 0.000051
Family DPY module 0.0015
Further Details:      
 
Domain Number 40 Region: 7184-7207
Classification Level Classification E-value
Superfamily DPY module 0.000051
Family DPY module 0.0017
Further Details:      
 
Domain Number 41 Region: 15281-15304
Classification Level Classification E-value
Superfamily DPY module 0.0000536
Family DPY module 0.0016
Further Details:      
 
Domain Number 42 Region: 16153-16176
Classification Level Classification E-value
Superfamily DPY module 0.0000536
Family DPY module 0.0018
Further Details:      
 
Domain Number 43 Region: 17149-17172
Classification Level Classification E-value
Superfamily DPY module 0.0000536
Family DPY module 0.0014
Further Details:      
 
Domain Number 44 Region: 18129-18152
Classification Level Classification E-value
Superfamily DPY module 0.0000589
Family DPY module 0.0011
Further Details:      
 
Domain Number 45 Region: 9222-9245
Classification Level Classification E-value
Superfamily DPY module 0.0000628
Family DPY module 0.0012
Further Details:      
 
Domain Number 46 Region: 9644-9667
Classification Level Classification E-value
Superfamily DPY module 0.0000628
Family DPY module 0.0013
Further Details:      
 
Domain Number 47 Region: 11984-12007
Classification Level Classification E-value
Superfamily DPY module 0.0000628
Family DPY module 0.0014
Further Details:      
 
Domain Number 48 Region: 14108-14131
Classification Level Classification E-value
Superfamily DPY module 0.0000732
Family DPY module 0.001
Further Details:      
 
Domain Number 49 Region: 14214-14237
Classification Level Classification E-value
Superfamily DPY module 0.000085
Family DPY module 0.0015
Further Details:      
 
Domain Number 50 Region: 7081-7104
Classification Level Classification E-value
Superfamily DPY module 0.0000942
Family DPY module 0.0014
Further Details:      
 
Weak hits

Sequence:  FBpp0304627
Domain Number - Region: 10605-10628
Classification Level Classification E-value
Superfamily DPY module 0.000101
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 14428-14451
Classification Level Classification E-value
Superfamily DPY module 0.000101
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 14870-15024
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000104
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number - Region: 7503-7526
Classification Level Classification E-value
Superfamily DPY module 0.000115
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 10069-10092
Classification Level Classification E-value
Superfamily DPY module 0.000122
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 13575-13598
Classification Level Classification E-value
Superfamily DPY module 0.000127
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 12936-12959
Classification Level Classification E-value
Superfamily DPY module 0.000129
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 12617-12640
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 15173-15196
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 10411-10562
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000137
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 9861-9884
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 7939-7962
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 9326-9349
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 18327-18349
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 6759-6781
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 9431-9454
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 8472-8495
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 6865-6888
Classification Level Classification E-value
Superfamily DPY module 0.000196
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 11664-11687
Classification Level Classification E-value
Superfamily DPY module 0.000196
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 13048-13071
Classification Level Classification E-value
Superfamily DPY module 0.000196
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 15068-15091
Classification Level Classification E-value
Superfamily DPY module 0.000196
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 15135-15168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000212
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 10921-10944
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 11880-11903
Classification Level Classification E-value
Superfamily DPY module 0.000235
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 18235-18257
Classification Level Classification E-value
Superfamily DPY module 0.000275
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 10282-10305
Classification Level Classification E-value
Superfamily DPY module 0.000288
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 8702-8850
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000298
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 9541-9564
Classification Level Classification E-value
Superfamily DPY module 0.000301
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 9967-9990
Classification Level Classification E-value
Superfamily DPY module 0.000301
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 7613-7636
Classification Level Classification E-value
Superfamily DPY module 0.00034
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 11346-11369
Classification Level Classification E-value
Superfamily DPY module 0.00034
Family DPY module 0.0011
Further Details:      
 
Domain Number - Region: 14534-14557
Classification Level Classification E-value
Superfamily DPY module 0.00034
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 14853-14876
Classification Level Classification E-value
Superfamily DPY module 0.00034
Family DPY module 0.0026
Further Details:      
 
Domain Number - Region: 8580-8603
Classification Level Classification E-value
Superfamily DPY module 0.000379
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 13161-13313
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000392
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number - Region: 10707-10730
Classification Level Classification E-value
Superfamily DPY module 0.000536
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 10175-10198
Classification Level Classification E-value
Superfamily DPY module 0.000667
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 15781-15874
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000706
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number - Region: 7829-7852
Classification Level Classification E-value
Superfamily DPY module 0.000745
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 14323-14346
Classification Level Classification E-value
Superfamily DPY module 0.000745
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 17279-17434
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000753
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number - Region: 15494-15517
Classification Level Classification E-value
Superfamily DPY module 0.00106
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 9112-9135
Classification Level Classification E-value
Superfamily DPY module 0.0012
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 13648-13745
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00152
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 9750-9773
Classification Level Classification E-value
Superfamily DPY module 0.00157
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 12514-12537
Classification Level Classification E-value
Superfamily DPY module 0.00157
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 17928-18077
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00173
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 18774-18797
Classification Level Classification E-value
Superfamily DPY module 0.00183
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 12733-12889
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00196
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 18904-18927
Classification Level Classification E-value
Superfamily DPY module 0.00196
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 8542-8575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00239
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 6545-6568
Classification Level Classification E-value
Superfamily DPY module 0.00262
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 13275-13422
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00267
Family Growth factor receptor domain 0.0074
Further Details:      
 
Domain Number - Region: 18393-18416
Classification Level Classification E-value
Superfamily DPY module 0.00314
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 15887-15921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00362
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 7250-7284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00373
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 9394-9426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00394
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 15347-15381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00403
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 14497-14529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00411
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 12260-12294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 9504-9536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00529
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 11992-12147
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00596
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 7041-7074
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0067
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 18515-18538
Classification Level Classification E-value
Superfamily DPY module 0.0068
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 15451-15488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00712
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 17232-17265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 17553-17586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0101
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 15243-15276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0105
Family Merozoite surface protein 1 (MSP-1) 0.061
Further Details:      
 
Domain Number - Region: 7148-7179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 168-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0119
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 8896-8919
Classification Level Classification E-value
Superfamily DPY module 0.0126
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 19550-19572
Classification Level Classification E-value
Superfamily DPY module 0.0131
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 6444-6465
Classification Level Classification E-value
Superfamily DPY module 0.0157
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 6225-6261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.018
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 10930-11090
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0188
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 10081-10234
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0196
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 17911-17934
Classification Level Classification E-value
Superfamily DPY module 0.0196
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 14816-14848
Classification Level Classification E-value
Superfamily EGF/Laminin 0.02
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 17873-17906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.021
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 13013-13109
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0251
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number - Region: 8433-8467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0284
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 7729-7888
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.033
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number - Region: 13903-14060
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.033
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 8965-8998
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 17003-17037
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0481
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 18715-18736
Classification Level Classification E-value
Superfamily DPY module 0.0497
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 6075-6234
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0534
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number - Region: 11102-11197
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0534
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 19803-19825
Classification Level Classification E-value
Superfamily DPY module 0.0536
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 12157-12190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0559
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 19741-19761
Classification Level Classification E-value
Superfamily DPY module 0.0575
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 14603-14636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0607
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 10353-10386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0617
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 17448-17478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0652
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 9187-9217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0698
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 19624-19644
Classification Level Classification E-value
Superfamily DPY module 0.0719
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 16010-16042
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0726
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 18196-18228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0731
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 10031-10064
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0754
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 11309-11341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0791
Family EGF-like domain of nidogen-1 0.051
Further Details:      
 
Domain Number - Region: 6357-6390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.088
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 19297-19319
Classification Level Classification E-value
Superfamily DPY module 0.0968
Family DPY module 0.0027
Further Details:      
 
Domain Number - Region: 7681-7713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0986
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 12687-12720
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0986
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 18089-18117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0995
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304627   Gene: FBgn0053196   Transcript: FBtr0332350
Sequence length 20404
Comment pep:known chromosome:BDGP5:2L:4477462:4591963:-1 gene:FBgn0053196 transcript:FBtr0332350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNE
STEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGY
GGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAAR
CVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP
DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD
ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEAACVLDTECGAFEVCQGGQCFNP
CLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLP
VCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVCLHNKCVYGCHVDDDCSASESCRNDK
CVNPCLENPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLA
CFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDNECGHGELCLGLNCVPGCRSDQGCPP
ELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVPRIACGRNED
CQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRTVCNTDEACAQGQICENRMCQTGCRT
DLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVNHGVQCQCPAAFMGDGLTGCQLPPER
CHPDCECDENGAYCAPKCSRTEDCACGQQCARGKCRNKCGPKRQCTVGQLCERGACIAGC
KSNGDCAADQSCVNGKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKECVQFE
CRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGNPTSECRPL
EGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACH
VLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRTLGCEVGGCVRQGYEYVCQQDTEQCY
SDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPEIECKSDPK
CVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPCNNPLFICESNKKCETRRHQPVC
ICKSGFIVNEYGELTCAPDKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSC
EVQNHKPVCICMRDCQPSISICLRDAGCPASQACRKLKCVDPCEFATCAPNSPCIVEDHK
PICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQAHQCGSSGKCIDPCLTSCAGGVKCV
VSAHRVTICTCPATLTNNTDSNCTSTDITVGTTTQRIETTTDFINVKYTVMQLANQTEMR
TRFTDIEAENETTGPYTTTTESYKTTKQLSSNPETETPTTLPSRPTTRPFTDQTTEFTSE
IPTITPMEGSTPTPSHLETTVASITSESTTREVYTIKPFDRSTPTPVSPDTTVPSITFET
TTNIPIGTTRGQVTEQTTSSPSEKRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDST
TRTYSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNDPIGSTGGQVTEQTT
SSPSEVRTTIGLEESTLPSRSTDRTTPSESPETPTTLPSDFITRPHSDQTTESTRDVPTT
RPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLP
SRSADRTTPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVP
SVTLETTTNVPIGSTGGQVTGQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTT
LPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSESPETPTTLPSDFTIRPHSEQTTEST
RDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRV
EESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPAS
LETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSES
PETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPI
GSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSE
KTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEV
RTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEAS
TPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADR
TTPSESPETPTTLPSDFITRTYSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSET
TTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFT
TRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTT
SSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPATR
PFEASTPSPASLETTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPS
RSTDRTSPSESPETPTTLPSDFTTRPHSDQTTECTRDVPTTRPFEASTPSSASLETTVPS
VTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLP
SDFTTRPHSEQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVT
EQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDV
PTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIRVEES
TLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLET
TVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTSPSESPET
PTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGST
GGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTT
ESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTT
IGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTRDVPTTRPFEASTPS
PASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSESPETPTTLPSDFTTRPHSEKTTESTR
DVPTTRPFETSTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVE
ESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLE
TTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPE
TPTTLPSDFITRPHSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGS
TGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSEKT
TESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRT
TIRVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTP
SSASSGNNCSISYFRNHYKCSNRFNRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTR
DVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIRVE
ESTLPSRSTDRTTPSESPETPTILPSDFTTRPHSDQTTESTRDVPTTRPFEASTPRPVTL
ETAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTIRVEESTLPSRSTDRTTPSESP
ETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIG
STGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQ
TTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVR
TTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEAST
PSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRT
TPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFEASTPRPVTLQTAVLPVTSETT
TNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTT
RPHSDQTTESSRDVPTTQPFESSTPRPVTLETAVPPVTSETTTNVPIGSTGGQVTEQTTP
SPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTR
PFESSTPRPVTLEIAVPPVTSETTTNVAIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPS
RSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPS
VTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTPPSESPETPTTL
PSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLEIAVPPVTSETTTNVPIGSTGGQV
TGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTR
DVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVE
ESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPRPVTL
ETAVPSVTSETTTNVPIGSTVTSETTTNVPIGSTGGQVAGQTTAPPSEVRTTIRVEESTL
PSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTSETTTNVPIGSTGGQLTEQSTSSPSEVRTTIRVEESTLPSRSTDRTFPSESPEKPT
TLPSDFTTRPHLEQTTESTRDVLTTRPFETSTPSPVSLETTVPSVTSETSTNVPIGSTGG
QVTEQTTAPPSVRTTETIVKSTHPAVSPDTTIPSEIPATRVPLESTTRLYTDQTIPPGST
DRTTSSERPDESTRLTSEESTETTRPVPTVSPRDALETTVTSLITETTKTTSGGTPRGQV
TERTTKSVSELTTGRSSDVVTERTMPSNISSTTTVFNNSEPVSDNLPTTISITVTDSPTT
VPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCTVQNLTICRTLNHTTKCYCDTDDDVN
RPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCSAEHGR
TPGCEHCPPGANCDPTTGACIKANVTITTITTKNSTSTKIPTKPRTTANPNTGVKTTPTT
TRVTTRNTTTTTTTTTTSSTSTESSTITSATNQTSKNQKPDTESTTSHTDATRRYRDGEN
NITDTPTPRPTIQTTTLRGEGVMGDSQRRSTTTPKMKTTRLDTSNEVPDTTSPWPIELPT
TEGTTTEVYNTMFAPVVNTTDTSLINPCTVDTNCAPNEHCKLGHCRKKEPPGSPKTPEPC
QSNNDCIESEACYMGLCQDPCEFAKICAATAKCTAKSHRPVCTCPQGHEGNPMVKCVTTQ
TSIECTDDSDCGVTEACINQLCQHPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVG
CQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQEDSCGENAECIPVNHGTECRCLPGFLG
NAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQCGAYALCDVVNHRGVCKCPPGYNGNP
KVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCGPN
SGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPN
YVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHPVCYCPDNKIGNPFRLCDKPAVTIEL
CQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDG
QTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEE
HHPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDP
QSGCQPECDINSDCGDTLSCINHKCVDPCAGAICGINAICNVRQHTPVCLCLDGFVGDAF
LQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPECVGNS
DCPFDRACLGQRCLDPCPGSCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPP
QPSCAKLHCGANAECKRQHSGLACVCRKGYFGDPHIGCRPECVLNSDCPAEKACLNSKCV
EACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSR
CKATPDGYAACSCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCPGICGGGARCE
VLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCS
CVANYIGSPPYCRPECTLSSECPSDKACINEKCQNPCANVCGHNARCTVIAHSAHCSCDE
DYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAVCTPYNNAARCTCIEPYNGDPYSTGC
RPECIYSSECPSSLACIKQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPFDGCKR
VVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCI
NQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPC
GSNSICRNVNNRAECSCAPGMFGAPPNCRPECVINQDCPSNRACIRQRCEDPCIGICGFN
AVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGS
CSCIQNYFGDPYINCRPECVQNSDCPNNRACINMKCRDPCANACGFNAICRVAHHQPVCS
CEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPP
NCKPECMTSAECPSDRACINQRCKDPCPGTCGYNARCRCTNHSPICSCYDGYTGDPFHQC
VPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPECSINS
ECPARMACINARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEV
IQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCV
DPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPC
GLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGTCGNN
ALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAAN
EQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACINLRCRDPCVGTCGIQTTCLVNNHRP
ICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDP
YTECRPECVLNSDCSKNRACLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQ
FCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQ
DRACVNQRCADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNE
NPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNCRPECTINTECPANLACINERCQDP
CPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAEC
RERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSRDKSCVNQKCVDPCPGVCGLNAQCRV
SNHLPSCSCLAGYTGNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSC
LQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDPCPGTCGIEARCQVINHYPACSCAPG
FTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCR
PECLSSADCPANLACVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIV
QQIAPPDETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDRS
RACINNKCQDPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKP
SPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGSC
GNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQA
ACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCS
CADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPY
DAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDP
FFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAE
CAPEKACVHKKCVDPCQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTT
PSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFIGAPPRCRPECVLNSECGPTEACINQ
KCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPC
GQNADCFAGECRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCPGICGNNAVC
EVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCL
EGYIGAPPQCRPECVVSSECSALQACVNKKCVDPCAAACGLEARCEVINHSPICGCPPGR
TGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNC
RPECIINPDCQSTQACINNKCSNPCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVP
QQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCI
RNKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSP
CGANSKCRVANGLAVCSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCAKTCGL
NAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRV
RDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNH
LAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQG
DPYTGCRPECTLSTDCAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDP
FVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSL
HTACVNRKCVDPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNP
CQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCRPECSINPECPPTKACIRQKCSDPCV
NACGFNARCNVANHQPICTCDVGYTGDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRE
RNGIGSCQCLPDHFGDPYQSCRPECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTN
HLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCL
ELYIGLPPNCRPECVLSTECPTDKACISQRCQDPCPGTCGINAECRVRNHSPLCQCRQGF
TGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGAPPNCR
PECTISAECPSNLACIRERCIDPCPGSCGYAAECSVVNHTPICVCPAGFTGDPFSSCRPA
PPPEPTQSEYVDPCNPSPCGPNAQCNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDKAC
HSSKCVNPCPGTCGENAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPCRPSPCGP
NSQCREVNQQAVCSCLPSFIGAPPSCRPECTSNSECAPTQACLNQRCGDPCPGTCGVGAN
CAVVSHSPFCTCPERFTGNPFIRCQPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPA
CSCVETYIGRPPNCRPECVTSSDCSSQLACVNQKCVDPCPGRCGLNAECFVVSHAVQCIC
QQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGC
RPECMLDSDCPSNRACQQLRCQDPCPGTCGLNANCQVVNHLPTCTCLTGYVGDPYRQCNR
LPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADR
ACVNQKCVDPCAADTCGNNAICRVRNHSPICSCISGYTGDAFTRCFLIPPPIIETKDEPL
RDPCIPTPCGPNSECRNINGVPACSCLVNFIGQAPNCRPECTINSECPSQLACINQKCRD
PCPGACGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGAN
AQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPCSGTCGVNALCEVN
NHIPICRCPEQMSGNAFFECRPVPPAKIQNPCQPSPCGPNSQCRVVQQTAVCSCLANYVG
SPPQCRPECVTNSDCPADQDCQNMKCRDPCPGTCGFNALCNVVNHRPFCSCPTGMSGNPF
VSCQQLIIRDERPQNPCQPSPCGPNSECRVSGDSPSCSCLPEFVGAPPNCRPECISNSEC
PTNQACINQKCVDPCPGLCGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPIRDSPPEVLQ
PCNPSPCGVNAKCEERGGAGSCQCLPDYFGNPYDGCRPECVLNSDCPSNQACVNQKCRDP
CPGTCGQNAECQVVNHLATCNCLVGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQ
CREVNEQGVCSCLPEFIGSPPACRPECTSSSECAADKACVNRKCVDPCPNVCGQQAECRV
RNHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCS
CLPQYLGTPPNCRPECSINAECPSHQACINQKCRDPCPGSCGLNTQCSVINHTPICSCLA
GYIGDPFSVCNPEPIPEKIRDPLPPEDPCNPSPCGSNTQCNNGVCSCLPEYHGDPYTGCR
PECVLHTDCDRSRACVRHKCVDPCPGTCGTNAICEVLNHIPNCRCLEGMQGNAFIQCSPV
PKLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITSFIGSPPFCRPECTTNSECPLNLACR
NQKCSDPCPGVCGRGAQCHVTNHSPFCRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSP
CGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPGLCGQ
SAECRVLSHTPSCVCPEGMEGDPFTLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGS
CQCLPDYFGNPYEGCRPECVLNSDCPSNKACQQQKCQDPCPGTCGQNALCNVLNHIPSCS
CISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRP
ECTISSECPADKACVNQKCVDPCPNTCGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKP
PVPPTPVQKTPVDPCVPTPCGPYSQCRSQGDAPACSCLVGYIGAPPNCRPECRINAECPS
SQACINEKCRDPCPGSCGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLD
DPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPG
TCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQ
AVCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFC
TCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGS
PPYCKPECVANSECPSNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFT
QCQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCP
SNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPIVHEYVN
PCQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNCRPQCTSSSECASNRACINQKCVDPC
PGVCGQQAICEVRNHSPICRCPTAMIGDPFVRCIPRPTIAPPPLRDVAPYRDPCLPSPCG
LYASCRNQQNQAVCSCLPNYFGTPPHCRPECSINAECPSHLACIGERCRDPCPGACGQQT
ECRVISHVPSCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSNQGECKC
VADYQGDPYVACRPECVLSSECPRNLACIQQKCTDPCPGTCGTNAICDVVNHIAMCHCPD
RMTGNAFVQCTPVQLDVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECS
TNYDCSPSLACQNQRCVDPCPGACGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQ
RDITPKDPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRPECVSNSECSQVHVCSN
NRCKDPCPGLCGTDAVCRVISHSAMCYCQPGYSGDPFVRCAPHIQRESIEIVQPCNPNPC
GAFAECRQQNGVGSCQCLPEYFGNPYEGCRPECVLDSDCPSQLACVNQKCRDPCPGSCGQ
NAECFVRNHLPTCNCLSGYVGDPYRYCSIEPKPIREYVNPCQPSPCGPNSQCREQNGVAT
CSCLPEFVGTPPGCRPECTVSSECNLDKACVRHKCLDPCPGACGSSANCQVVNHAPLCSC
QAGYTGDPFTRCYPIPSPPTHIVHDYARHPCQPSPCGANAQCRQSQGQAICSCIPNYFGV
PPNCRPECTQSSECLSSLACINQRCADPCPGSCAYNAICHVRNHVPSCQCPVGYVGDPFT
NCHPEPQPPPKPVALDDPCNPSPCGANAVCQNGQCSCIPEYQGDPYTGCRPECVLNADCP
RNRACVRHKCVDPCPGTCAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPC
YPSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQRQHCIDPCPG
TCGFNALCHVVNHAPICSCPPKHNGNPFLGCFPEPVRRDEVIPKNPCQPSPCGPYAKCTS
VGDQAQCSCLPEYIGTPPNCRPECITNSECSFDKACLNQRCRDPCSGTCGSNANCHVISH
TAMCYCLPGFTGDPFTSCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYY
GNPYETCRPECVTNNDCPSNKACQQQKCRDPCPGVCALNALCRVINHLPTCHCQNGFVGD
PYRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTS
AECPHDKACIRQKCNDPCPGVCGSNADCRVIQHAPICSCRAGFTGDAFSRCLPLPPSRPP
QLDVYRNPCVPSPCGQYAECRDNQGTATCSCLPSYFGTPPNCRPECTINPDCPSHLSCQQ
QRCRDPCPGACGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLI
TCGPNAVCNQGQCNCLPEFVGNPLVGCRPECVLSTECDWSKACVRNKCIDPCPGTCGSNA
ICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRDVIDPCQPSPCGPNAQCRNINGQAVC
SCLRDFIGVPPSCRPECVSNAECPLHLACLQRHCRDPCPGVCGLNAECRVINHSPNCHCI
GSFTGNPFAACHRPPPPPIKHEPIDPCQPSPCGANAECRVQGSNAQCSCLSGFIGTPPNC
RPECVSNSDCPMNLACLNQKCRDPCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQV
VRDVPEPQTPCVPSPCGANALCSEGNGAGACKCLPEFYGNPYEGCRPECVLNSDCPSHLA
CLNQHCRDPCPGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQ
PSPCGPNSQCRESNNQAICKCLPNFIGSPPACRPECTISSECDLTLACVQQHCVDPCPGV
CGNSAQCRVINHSPHCSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVPSPCGAFGQ
CRAQGNQAICSCLPGYYGAPPNCRPECAINPDCASHLACISEKCRDPCPGSCGLQAQCSV
INHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQCSCLPDFD
GNPYVGCRPECVLNTDCARDKACQRSKCTDPCPGACGIGAVCEVRNHIPTCNCPPGTSGN
AFVQCTLVQSSPVVPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINS
DCAPHLACLNQQCRDPCPGACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQ
REPINPCYPSPCGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLACIGQK
CKDPCSGLCGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPIQREQINPCYQNPCGSN
AVCRERGEAASCQCLPEYYGNPYEGCRPECVLNSDCSSHLACLNQHCRDPCPGSCAPNAQ
CQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQPSPCGPNSQCTESQGQAVC
RCLPDYYGSPPACRPECTTNPECPNDKACVSRRCTDPCAGACGQNAICRAHQHRAYCSCH
PGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGT
PPYCRPECTQNSDCPSHRACVNQRCVDPCPGACGLNARCDVLNHVPSCSCPEGYLGDPFY
RCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNGVCSCLPLYQGDPYVGCRPECVLSTE
CPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVEL
HPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPACRPECVSDPECPPSLACVNQKCRDP
CPGACGHLAQCHVINHSPQCVCPAGYTGSPYSECHLIRADSSPIQRQPIDPCLPSPCGPH
AQCSNEGGNAVCRCLTEYLGVPPYCRPECIANSECPSDRACINRKCQDPCPGLCGYNAIC
RTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATPPTTAIQVLQYEEPFINGCEPNPCGA
NAQCNQRRGVVSCVCLPDYFGNPYEACRPECILNSDCPLSRACVQQKCRDPCPGTCGLNA
ECHVMDHLPQCRCFSGYTGNPLAYCSPVPIIQESPLTPCDPSPCGPNAQCHPSLNEAVCS
CLPEFYGTPPNCRPECTLNSECAYDKACVHHKCVDPCPGICGINADCRVHYHSPICYCIS
SHTGDPFTRCYETPKPVRPQIYDTPSPPYPVAIPDLVYVQQQQPGIVNIPSAPQPIYPTP
QSPQYNVNYPSPQPANPQKPGVVNIPSVPQPVYPSPQPPVYDVNYPTTPVSQHPGVVNIP
SAPRLVPPTSQRPVFITSPGNLSPTPQPGVINIPSVSQPGYPTPQSPIYDANYPTTQSPI
PQQPGVVNIPSVPSPSYPAPNPPVNYPTQPSPQIPVQPGVINIPSAPLPTTPPQHPPVFI
PSPESPSPAPKPGVINIPSVTHPEYPTSQVPVYDVNYSTTPSPIPQKPGVVNIPSAPQPV
HPAPNPPVHEFNYPTPPAVPQQPGVLNIPSYPTPVAPTPQSPIYIPSQEQPKPTTRPSVI
NVPSVPQPAYPTPQAPVYDVNYPTSPSVIPHQPGVVNIPSVPLPAPPVKQRPVFVPSPVH
PTPAPQPGVVNIPSVAQPVHPTYQPPVVERPAIYDVYYPPPPSRPGVINIPSPPRPVYPV
PQQPIYVPAPVLHIPAPRPVIHNIPSVPQPTYPHRNPPIQDVTYPAPQPSPPVPGIVNIP
SLPQPVSTPTSGVINIPSQASPPISVPTPGIVNIPSIPQPTPQRPSPGIINVPSVPQPIP
TAPSPGIINIPSVPQPLPSPTPGVINIPQQPTPPPLVQQPGIINIPSVQQPSTPTTQHPI
QDVQYETQRPQPTPGVINIPSVSQPTYPTQKPSYQDTSYPTVQPKPPVSGIINIPSVPQP
VPSLTPGVINLPSEPSYSAPIPKPGIINVPSIPEPIPSIPQNPVQEVYHDTQKPQAIPGV
VNVPSAPQPTPGRPYYDVAKPDFEFNPCYPSPCGPYSHCHNRFGVAACVCLPNYRGTPPN
CRPECVINSDCPSSLACINEKCRDPCPGSCAYNAVCRVHEHVPNCYCQTGYTGNPFISCQ
RTPIAPVQREPIEAKDPCYPSICGPNAVCNNGKCSCIPEYRGDPYVGCRPECVLNTDCAR
DKACIQQKCKNPCPGTCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPP
TTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTPPGCRPECTSNSDCP
LDKYCLNLRCRDPCPGACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEV
NPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPFCRPECVNSADCPADKACRNYKCIDP
CPGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFC
QPHNDLSVCQCLPGYYGNPSEICRPECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQV
INHSPVCECHTGHVGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCL
PEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGF
TGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCR
PECTINAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVL
PPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACV
NQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPS
PCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCG
LNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNG
QAECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCPGSCGQSAQCTVSLHIPN
CQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEY
IGNPYEGCRPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTG
NAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTL
SSDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEP
IDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAIC
RAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQS
NICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGF
TQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCN
CGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNP
CDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTE
ACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDS
ECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKIN
ADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQ
YNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPV
KTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTV
TDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQC
NCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAY
CHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGP
NAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCA
LNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPC
AQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPC
SVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQE
ACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACI
NGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTC
QNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPG
RQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKE
VGGCISDSDCPTDKSCLNSVCRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIE
CSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLG
CRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESER
HIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGN
PAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCAL
ERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCL
TKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTNFRTDFPRPDMVVSCLADGVQVEI
HITEPGFNGVLYVKGHSKDEECRRVVNLAGETVPRTEIFRVHFGSCGMQAVKDVASFVLV
IQKHPKLVTYKAQAYNIKCVYQTGEKNVTLGFNVSMLTTAGTIANTGPPPICQMRIITNE
GEEINSAEIGDNLKLQVDVEPATIYGGFARSCIAKTMEDNVQNEYLVTDENGCATDTSIF
GNWEYNPDTNSLLASFNAFKFPSSDNIRFQCNIRVCFGRCQPVNCGGYNAFGRRRRSIAD
NSTDATAIATNSGVEGQLREEITISSNAILTFEKRSGQGLNDANIKPAAQRVEDICVSMV
GLIIALVITALLALVAVAVAVSCWLMAYRRRPKTIAPLPHPPEFPNPLFSNPDAVPEPTP
DYIS
Download sequence
Identical sequences M9PB31
FBpp0304627 NP_001260037.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]