SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304628 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304628
Domain Number 1 Region: 264-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000111
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 2 Region: 181-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000345
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 623-760
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000188
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 4 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 2389-2433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000153
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 6 Region: 492-625
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000361
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 2221-2259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000455
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 454-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000594
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 408-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000223
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 13822-13845
Classification Level Classification E-value
Superfamily DPY module 0.00000366
Family DPY module 0.00058
Further Details:      
 
Domain Number 11 Region: 15414-15437
Classification Level Classification E-value
Superfamily DPY module 0.00000405
Family DPY module 0.00085
Further Details:      
 
Domain Number 12 Region: 1334-1474
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000534
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 13 Region: 9984-10007
Classification Level Classification E-value
Superfamily DPY module 0.00000641
Family DPY module 0.001
Further Details:      
 
Domain Number 14 Region: 958-1070
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000643
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 15 Region: 13716-13739
Classification Level Classification E-value
Superfamily DPY module 0.00000719
Family DPY module 0.00098
Further Details:      
 
Domain Number 16 Region: 10319-10473
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000847
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 17 Region: 13403-13426
Classification Level Classification E-value
Superfamily DPY module 0.00000929
Family DPY module 0.001
Further Details:      
 
Domain Number 18 Region: 14990-15013
Classification Level Classification E-value
Superfamily DPY module 0.0000119
Family DPY module 0.00091
Further Details:      
 
Domain Number 19 Region: 14461-14484
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.00091
Further Details:      
 
Domain Number 20 Region: 14564-14587
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.0013
Further Details:      
 
Domain Number 21 Region: 826-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000167
Family EGF-type module 0.012
Further Details:      
 
Domain Number 22 Region: 11057-11080
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.0011
Further Details:      
 
Domain Number 23 Region: 15095-15118
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.00083
Further Details:      
 
Domain Number 24 Region: 14355-14378
Classification Level Classification E-value
Superfamily DPY module 0.0000183
Family DPY module 0.001
Further Details:      
 
Domain Number 25 Region: 15209-15369
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000022
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 26 Region: 9661-9684
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.00089
Further Details:      
 
Domain Number 27 Region: 13508-13531
Classification Level Classification E-value
Superfamily DPY module 0.0000235
Family DPY module 0.0013
Further Details:      
 
Domain Number 28 Region: 9554-9577
Classification Level Classification E-value
Superfamily DPY module 0.0000248
Family DPY module 0.001
Further Details:      
 
Domain Number 29 Region: 10522-10545
Classification Level Classification E-value
Superfamily DPY module 0.0000248
Family DPY module 0.0012
Further Details:      
 
Domain Number 30 Region: 1141-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.016
Further Details:      
 
Domain Number 31 Region: 10629-10652
Classification Level Classification E-value
Superfamily DPY module 0.0000275
Family DPY module 0.0013
Further Details:      
 
Domain Number 32 Region: 14038-14061
Classification Level Classification E-value
Superfamily DPY module 0.0000275
Family DPY module 0.00093
Further Details:      
 
Domain Number 33 Region: 12656-12679
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.0013
Further Details:      
 
Domain Number 34 Region: 13292-13315
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.0015
Further Details:      
 
Domain Number 35 Region: 915-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000345
Family EGF-type module 0.017
Further Details:      
 
Domain Number 36 Region: 13080-13103
Classification Level Classification E-value
Superfamily DPY module 0.0000366
Family DPY module 0.0014
Further Details:      
 
Domain Number 37 Region: 9238-9261
Classification Level Classification E-value
Superfamily DPY module 0.0000379
Family DPY module 0.0013
Further Details:      
 
Domain Number 38 Region: 8918-8941
Classification Level Classification E-value
Superfamily DPY module 0.0000445
Family DPY module 0.0015
Further Details:      
 
Domain Number 39 Region: 9449-9472
Classification Level Classification E-value
Superfamily DPY module 0.0000445
Family DPY module 0.0017
Further Details:      
 
Domain Number 40 Region: 15739-15762
Classification Level Classification E-value
Superfamily DPY module 0.000051
Family DPY module 0.0011
Further Details:      
 
Domain Number 41 Region: 14249-14272
Classification Level Classification E-value
Superfamily DPY module 0.0000536
Family DPY module 0.0014
Further Details:      
 
Domain Number 42 Region: 11487-11510
Classification Level Classification E-value
Superfamily DPY module 0.0000549
Family DPY module 0.0012
Further Details:      
 
Domain Number 43 Region: 11909-11932
Classification Level Classification E-value
Superfamily DPY module 0.0000549
Family DPY module 0.0013
Further Details:      
 
Domain Number 44 Region: 2746-2790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000641
Family EGF-type module 0.025
Further Details:      
 
Domain Number 45 Region: 9346-9369
Classification Level Classification E-value
Superfamily DPY module 0.0000824
Family DPY module 0.0014
Further Details:      
 
Domain Number 46 Region: 12870-12893
Classification Level Classification E-value
Superfamily DPY module 0.0000876
Family DPY module 0.0016
Further Details:      
 
Weak hits

Sequence:  FBpp0304628
Domain Number - Region: 9768-9791
Classification Level Classification E-value
Superfamily DPY module 0.000101
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 12334-12357
Classification Level Classification E-value
Superfamily DPY module 0.000106
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 14882-14905
Classification Level Classification E-value
Superfamily DPY module 0.000119
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 12126-12149
Classification Level Classification E-value
Superfamily DPY module 0.00012
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 10204-10227
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 11591-11614
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 11696-11719
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 15937-15959
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 9024-9046
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 10737-10760
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 9130-9153
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 13929-13952
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 13186-13209
Classification Level Classification E-value
Superfamily DPY module 0.000196
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 10967-11115
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000204
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 14145-14168
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 15845-15867
Classification Level Classification E-value
Superfamily DPY module 0.000235
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 12547-12570
Classification Level Classification E-value
Superfamily DPY module 0.000248
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 11806-11829
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 12232-12255
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 13611-13634
Classification Level Classification E-value
Superfamily DPY module 0.000288
Family DPY module 0.0011
Further Details:      
 
Domain Number - Region: 9878-9901
Classification Level Classification E-value
Superfamily DPY module 0.000301
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 15628-15651
Classification Level Classification E-value
Superfamily DPY module 0.000301
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 10845-10868
Classification Level Classification E-value
Superfamily DPY module 0.000327
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 14638-14736
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000361
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 12665-12827
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000471
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 12972-12995
Classification Level Classification E-value
Superfamily DPY module 0.000471
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 12440-12463
Classification Level Classification E-value
Superfamily DPY module 0.000575
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 10094-10117
Classification Level Classification E-value
Superfamily DPY module 0.000641
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 11377-11400
Classification Level Classification E-value
Superfamily DPY module 0.00105
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 10807-10840
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00123
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 12015-12038
Classification Level Classification E-value
Superfamily DPY module 0.00131
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 14779-14802
Classification Level Classification E-value
Superfamily DPY module 0.00131
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 2342-2501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00133
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 16384-16407
Classification Level Classification E-value
Superfamily DPY module 0.00157
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 16514-16537
Classification Level Classification E-value
Superfamily DPY module 0.0017
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 14998-15154
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00188
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 9515-9549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00192
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 8810-8833
Classification Level Classification E-value
Superfamily DPY module 0.00235
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 16003-16026
Classification Level Classification E-value
Superfamily DPY module 0.00275
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 11769-11801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0028
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 15536-15687
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00377
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 9306-9339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00469
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 14527-14623
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00487
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 15163-15196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00518
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 16125-16148
Classification Level Classification E-value
Superfamily DPY module 0.00589
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 9413-9444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00592
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 2632-2795
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00628
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 9776-9936
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00863
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 11578-11755
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00926
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 8490-8526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00937
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 14257-14412
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00989
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 15483-15516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 11161-11184
Classification Level Classification E-value
Superfamily DPY module 0.0109
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 17160-17182
Classification Level Classification E-value
Superfamily DPY module 0.0119
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 13724-13880
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0133
Family Growth factor receptor domain 0.0074
Further Details:      
 
Domain Number - Region: 10698-10732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0135
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 13195-13355
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0141
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 8709-8730
Classification Level Classification E-value
Superfamily DPY module 0.0144
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 11230-11263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0168
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 15521-15544
Classification Level Classification E-value
Superfamily DPY module 0.017
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 876-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0272
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 790-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0296
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 12618-12651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0305
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 15806-15838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0306
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 13678-13711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family EGF-type module 0.055
Further Details:      
 
Domain Number - Region: 8771-8804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0325
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 13367-13462
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.033
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 12346-12499
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0392
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 13574-13606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0393
Family EGF-like domain of nidogen-1 0.051
Further Details:      
 
Domain Number - Region: 9730-9763
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0405
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 12296-12329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 16325-16346
Classification Level Classification E-value
Superfamily DPY module 0.0432
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 1827-1946
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0439
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 8622-8655
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0457
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 17413-17435
Classification Level Classification E-value
Superfamily DPY module 0.0471
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 9946-9978
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0475
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 12506-12541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0503
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 14952-14985
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0503
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 15699-15727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0509
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 17351-17371
Classification Level Classification E-value
Superfamily DPY module 0.051
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 12933-12967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0559
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 13149-13180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0607
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 14422-14455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0614
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 17234-17254
Classification Level Classification E-value
Superfamily DPY module 0.0628
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 9033-9189
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0691
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 16677-16720
Classification Level Classification E-value
Superfamily EGF/Laminin 0.074
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 8340-8499
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0816
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number - Region: 16907-16929
Classification Level Classification E-value
Superfamily DPY module 0.085
Family DPY module 0.0027
Further Details:      
 
Domain Number - Region: 2498-2519
Classification Level Classification E-value
Superfamily DPY module 0.0863
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 10590-10623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0873
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 11871-11903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0898
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 14000-14033
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0904
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 16067-16087
Classification Level Classification E-value
Superfamily DPY module 0.0955
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 9202-9233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.1
Family EGF-type module 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304628   Gene: FBgn0053196   Transcript: FBtr0332351
Sequence length 18014
Comment pep:known chromosome:BDGP5:2L:4477462:4595054:-1 gene:FBgn0053196 transcript:FBtr0332351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNE
STEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGY
GGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAAR
CVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP
DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD
ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGS
FQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQP
DGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFV
CTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACE
QVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNT
PGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAA
GCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKC
GAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPE
PNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAE
KAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCI
CRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEI
CNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSC
VDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAAN
EKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLL
GCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC
ASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGD
GALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVC
GIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPG
TFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK
PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQ
KGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICF
QLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEE
DKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNP
VVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCD
CLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAV
CVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEES
CGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKC
PPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVC
SCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNV
CVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCS
IDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAV
GERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIG
TPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCA
NNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHV
DCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQ
PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCE
RQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPC
SLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSP
LCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLS
DAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSN
DKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCG
PGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVC
AQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSV
CKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKE
CVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVC
LHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNP
TPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN
ECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCL
CPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRT
VCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVN
HGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKC
RNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTV
SEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCR
VVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAH
QGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRT
LGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTV
LHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCT
DPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMAC
SDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACR
KLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQ
AHQCGSSGKCIDPCLTSCAGGVKCVVSAHRVTICTCPATLTNNTDSNCTSTDITVGTTTQ
RIETTTDFINVKYTVMQLANQTEMRTRFTDIEAENETTGPYTTTTESYKTTKQLSSNPET
ETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSESTTREVYT
IKPFDRSTPTPVSPDTTVPSITFETTTNIPIGTTRGQVTEQTTSSPSEKRTTIRVEESTL
PSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNDPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTTPSESPETPT
TLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGG
QVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTES
TRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTSSPSEVRTTIR
VEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSA
SLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSE
SPETPTTLPSDFTIRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVP
IGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYS
DQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSE
VRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEA
STPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSAD
RTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLE
TTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDF
TTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQT
TSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRTYSDQTTESTRDVPT
TRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTL
PSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPT
LPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVPIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTECT
RDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRV
EESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSASL
ETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESP
ETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGS
TGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQT
TESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRT
TIGVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTP
SPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTS
PSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTT
NVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITR
PHSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSES
PETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQ
TTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVR
TTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTRDVPTTRPFEAST
PSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRT
TPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETT
TSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFIT
RPHSEKTTESTRDVPTTRPFEASTPSSASSGNNCSISYFRNHYKCSNRFNRSADRTTPSE
SPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPI
GSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEV
RTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEAS
TPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDR
TSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSET
TTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFI
TRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTT
SSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTT
QPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLP
SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLETAVP
PVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTT
LPSDFTTRPHSDQTTESTRDVPTTRPFESSTPRPVTLEIAVPPVTSETTTNVAIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTEST
RDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRV
EESTLPSRSTDRTPPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVT
LEIAVPPVTSETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSES
PETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTTNVPIGSTVTSETTTNVPIGSTG
GQVAGQTTAPPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTE
STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPSEVRTTI
RVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFETSTPSP
VSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDTTIPSE
IPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRDA
LETTVTSLITETTKTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERTMPSNISSTTTV
FNNSEPVSDNLPTTISITVTDSPTTVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCT
VQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTF
NNPCSRNEDCRVFNHQPLCSAEHGRTPGCEHCPPGANCDPTTGACIKVECTDDSDCGVTE
ACINQLCQHPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDC
PPTKLCDRLNRRCINPCQEDSCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSD
SECDSSQACINGKCSSPCQCGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNP
CGLNALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCL
PEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPI
NPCDPNPCGTGAICDSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVA
GNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPT
SVIGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNP
GIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCG
DTLSCINHKCVDPCAGAICGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRD
PCAPSPCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLD
PCPGSCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAEC
KRQHSGLACVCRKGYFGDPHIGCRPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRV
VNHAPVCICAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLP
NFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFE
GDPFVACSPIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPE
CTLSSECPSDKACINEKCQNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKIT
ERPGDHIDPCYPNPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLA
CIKQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPC
GPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFN
AKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAEC
SCAPGMFGAPPNCRPECVINQDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCI
ESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINC
RPECVQNSDCPNNRACINMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVE
RPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSD
RACINQRCKDPCPGTCGYNARCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVP
PNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCAD
PCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALC
EERNQAAACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAV
FNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVC
SCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCS
PGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRA
PNCRPECTSDSECPGNLACINLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSE
CSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCS
KNRACLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPC
RPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPG
TCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCR
VVGETGVCSCLPNFVGRAPNCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVN
HSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEY
FGDPYSGCRPECVVNSDCSRDKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTG
NPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPEC
IISSDCAQNLNCQNQKCVDPCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLE
PPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLAC
VNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNP
SPCGANAICRERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGA
CGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSH
AVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPIC
TCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTC
RPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQL
IPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDD
CTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPL
NPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDP
CQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGP
NAKCQIVGNSPACSCLPNFIGAPPRCRPECVLNSECGPTEACINQKCADPCSGSCGFEAK
CHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQN
NYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCPGICGNNAVCEVMNHIPVCSCVKGY
EGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECV
VSSECSALQACVNKKCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIA
VPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQA
CINNKCSNPCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCG
PNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLN
AQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAV
CSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICSC
PLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIG
APPNCRPECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPF
VRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTD
CAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPC
QPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPG
ACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVL
NGNAACSCAATFIGTPPSCRPECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQ
PICTCDVGYTGDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFG
DPYQSCRPECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDP
YRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECV
LSTECPTDKACISQRCQDPCPGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPP
PVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRPECTISAECPSNLAC
IRERCIDPCPGSCGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCN
PSPCGPNAQCNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGTCGE
NAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSC
LPSFIGAPPSCRPECTSNSECAPTQACLNQRCGDPCPGTCGVGANCAVVSHSPFCTCPER
FTGNPFIRCQPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCR
PECVTSSDCSSQLACVNQKCVDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPE
IAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRA
CQQLRCQDPCPGTCGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQP
TPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADT
CGNNAICRVRNHSPICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSEC
RNINGVPACSCLVNFIGQAPNCRPECTINSECPSQLACINQKCRDPCPGACGQNAVCSVI
NHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYK
GDPYVSCRPECVLNTDCPRDRACVRNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGN
AFFECRPVPPAKIQNPCQPSPCGPNSQCRVVQQTAVCSCLANYVGSPPQCRPECVTNSDC
PADQDCQNMKCRDPCPGTCGFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQN
PCQPSPCGPNSECRVSGDSPSCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPC
PGLCGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPCGVNAKCEE
RGGAGSCQCLPDYFGNPYDGCRPECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVN
HLATCNCLVGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPE
FIGSPPACRPECTSSSECAADKACVNRKCVDPCPNVCGQQAECRVRNHNPICTCLSGFTG
DPFTRCYRQPPPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCRPE
CSINAECPSHQACINQKCRDPCPGSCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPI
PEKIRDPLPPEDPCNPSPCGSNTQCNNGVCSCLPEYHGDPYTGCRPECVLHTDCDRSRAC
VRHKCVDPCPGTCGTNAICEVLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPC
GPNSQCRVVNQQAICSCITSFIGSPPFCRPECTTNSECPLNLACRNQKCSDPCPGVCGRG
AQCHVTNHSPFCRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPS
CTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPGLCGQSAECRVLSHTPSCVC
PEGMEGDPFTLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGC
RPECVLNSDCPSNKACQQQKCQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVP
EPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACV
NQKCVDPCPNTCGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPC
VPTPCGPYSQCRSQGDAPACSCLVGYIGAPPNCRPECRINAECPSSQACINEKCRDPCPG
SCGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCN
NGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVP
MCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPL
CRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQ
QIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECP
SNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPC
QPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCP
GSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPPAPEYVNPCQPSPCGANSQCRE
SQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNH
SPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLP
NYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYT
GDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLN
SDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPP
PTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNK
CVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCG
PNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCPGSCGQSA
QCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGEN
YVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIP
ICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPL
AQGCRPECTLSSDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFV
QCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPC
LNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACIN
QVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACV
NQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLAC
RNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKL
ACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGC
TSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPP
EIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQV
QCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNP
FISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQG
NPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRA
MACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQ
CTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPC
AADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINT
QCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECI
NPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNEC
VSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLA
CIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGC
ESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVD
GECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSS
NNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQP
ICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKG
GCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCNCGLNAECRIKDHKPVCTCRQGFEG
NPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGG
NARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTV
PGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMI
CECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRI
DESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNL
DTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNHTNFRTDFPRPDMVVS
CLADGVQVEIHITEPGFNGVLYVKGHSKDEECRRVVNLAGETVPRTEIFRVHFGSCGMQA
VKDVASFVLVIQKHPKLVTYKAQAYNIKCVYQTGEKNVTLGFNVSMLTTAGTIANTGPPP
ICQMRIITNEGEEINSAEIGDNLKLQVDVEPATIYGGFARSCIAKTMEDNVQNEYLVTDE
NGCATDTSIFGNWEYNPDTNSLLASFNAFKFPSSDNIRFQCNIRVCFGRCQPVNCGGYNA
FGRRRRSIADNSTDATAIATNSGVEGQLREEITISSNAILTFEKRSGQGLNDANIKPAAQ
RVEDICVSMVGLIIALVITALLALVAVAVAVSCWLMAYRRRPKTIAPLPHPPEFPNPLFS
NPDAVPEPTPDYIS
Download sequence
Identical sequences M9PBZ4
NP_001260038.1.81976 FBpp0304628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]