SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304630 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304630
Domain Number 1 Region: 264-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000113
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 2 Region: 181-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000345
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 623-760
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000204
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 4 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 2389-2433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000153
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 6 Region: 492-625
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000314
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 2221-2259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000455
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 454-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000594
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 9998-10162
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000989
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 408-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000223
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 9248-9271
Classification Level Classification E-value
Superfamily DPY module 0.00000366
Family DPY module 0.00058
Further Details:      
 
Domain Number 12 Region: 15495-15518
Classification Level Classification E-value
Superfamily DPY module 0.00000405
Family DPY module 0.00085
Further Details:      
 
Domain Number 13 Region: 1429-1467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000432
Family EGF-type module 0.028
Further Details:      
 
Domain Number 14 Region: 5410-5433
Classification Level Classification E-value
Superfamily DPY module 0.00000641
Family DPY module 0.001
Further Details:      
 
Domain Number 15 Region: 9142-9165
Classification Level Classification E-value
Superfamily DPY module 0.00000719
Family DPY module 0.00098
Further Details:      
 
Domain Number 16 Region: 12332-12355
Classification Level Classification E-value
Superfamily DPY module 0.00000719
Family DPY module 0.00093
Further Details:      
 
Domain Number 17 Region: 14733-14756
Classification Level Classification E-value
Superfamily DPY module 0.00000759
Family DPY module 0.00087
Further Details:      
 
Domain Number 18 Region: 958-1070
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000863
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 19 Region: 5745-5899
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000942
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 20 Region: 8829-8852
Classification Level Classification E-value
Superfamily DPY module 0.00000942
Family DPY module 0.001
Further Details:      
 
Domain Number 21 Region: 10416-10439
Classification Level Classification E-value
Superfamily DPY module 0.000012
Family DPY module 0.00091
Further Details:      
 
Domain Number 22 Region: 13739-13762
Classification Level Classification E-value
Superfamily DPY module 0.0000122
Family DPY module 0.00095
Further Details:      
 
Domain Number 23 Region: 10844-10867
Classification Level Classification E-value
Superfamily DPY module 0.0000144
Family DPY module 0.0012
Further Details:      
 
Domain Number 24 Region: 826-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000147
Family EGF-type module 0.012
Further Details:      
 
Domain Number 25 Region: 9887-9910
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.00091
Further Details:      
 
Domain Number 26 Region: 11161-11184
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.00087
Further Details:      
 
Domain Number 27 Region: 12437-12460
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.00093
Further Details:      
 
Domain Number 28 Region: 6483-6506
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.0011
Further Details:      
 
Domain Number 29 Region: 10521-10544
Classification Level Classification E-value
Superfamily DPY module 0.000017
Family DPY module 0.00083
Further Details:      
 
Domain Number 30 Region: 9781-9804
Classification Level Classification E-value
Superfamily DPY module 0.0000183
Family DPY module 0.001
Further Details:      
 
Domain Number 31 Region: 13617-13640
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.0011
Further Details:      
 
Domain Number 32 Region: 15290-15450
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000022
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 33 Region: 5087-5110
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.00089
Further Details:      
 
Domain Number 34 Region: 11692-11715
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.0014
Further Details:      
 
Domain Number 35 Region: 8934-8957
Classification Level Classification E-value
Superfamily DPY module 0.0000235
Family DPY module 0.0013
Further Details:      
 
Domain Number 36 Region: 4980-5003
Classification Level Classification E-value
Superfamily DPY module 0.0000248
Family DPY module 0.001
Further Details:      
 
Domain Number 37 Region: 5948-5971
Classification Level Classification E-value
Superfamily DPY module 0.0000248
Family DPY module 0.0012
Further Details:      
 
Domain Number 38 Region: 1141-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.016
Further Details:      
 
Domain Number 39 Region: 6055-6078
Classification Level Classification E-value
Superfamily DPY module 0.0000275
Family DPY module 0.0013
Further Details:      
 
Domain Number 40 Region: 9464-9487
Classification Level Classification E-value
Superfamily DPY module 0.0000275
Family DPY module 0.00093
Further Details:      
 
Domain Number 41 Region: 11481-11504
Classification Level Classification E-value
Superfamily DPY module 0.0000275
Family DPY module 0.0011
Further Details:      
 
Domain Number 42 Region: 13296-13319
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.0011
Further Details:      
 
Domain Number 43 Region: 13403-13426
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.0019
Further Details:      
 
Domain Number 44 Region: 13078-13101
Classification Level Classification E-value
Superfamily DPY module 0.0000301
Family DPY module 0.0011
Further Details:      
 
Domain Number 45 Region: 8082-8105
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.0013
Further Details:      
 
Domain Number 46 Region: 8718-8741
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.0015
Further Details:      
 
Domain Number 47 Region: 15175-15198
Classification Level Classification E-value
Superfamily DPY module 0.000034
Family DPY module 0.001
Further Details:      
 
Domain Number 48 Region: 915-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000345
Family EGF-type module 0.017
Further Details:      
 
Domain Number 49 Region: 8506-8529
Classification Level Classification E-value
Superfamily DPY module 0.0000366
Family DPY module 0.0014
Further Details:      
 
Domain Number 50 Region: 4664-4687
Classification Level Classification E-value
Superfamily DPY module 0.0000379
Family DPY module 0.0013
Further Details:      
 
Domain Number 51 Region: 4344-4367
Classification Level Classification E-value
Superfamily DPY module 0.0000445
Family DPY module 0.0015
Further Details:      
 
Domain Number 52 Region: 4875-4898
Classification Level Classification E-value
Superfamily DPY module 0.0000445
Family DPY module 0.0017
Further Details:      
 
Domain Number 53 Region: 13844-13867
Classification Level Classification E-value
Superfamily DPY module 0.0000458
Family DPY module 0.0018
Further Details:      
 
Domain Number 54 Region: 12972-12995
Classification Level Classification E-value
Superfamily DPY module 0.0000471
Family DPY module 0.0016
Further Details:      
 
Domain Number 55 Region: 14840-14863
Classification Level Classification E-value
Superfamily DPY module 0.0000471
Family DPY module 0.0014
Further Details:      
 
Domain Number 56 Region: 15820-15843
Classification Level Classification E-value
Superfamily DPY module 0.000051
Family DPY module 0.0011
Further Details:      
 
Domain Number 57 Region: 6913-6936
Classification Level Classification E-value
Superfamily DPY module 0.0000549
Family DPY module 0.0012
Further Details:      
 
Domain Number 58 Region: 7335-7358
Classification Level Classification E-value
Superfamily DPY module 0.0000549
Family DPY module 0.0013
Further Details:      
 
Domain Number 59 Region: 9675-9698
Classification Level Classification E-value
Superfamily DPY module 0.0000549
Family DPY module 0.0014
Further Details:      
 
Domain Number 60 Region: 11799-11822
Classification Level Classification E-value
Superfamily DPY module 0.0000641
Family DPY module 0.001
Further Details:      
 
Domain Number 61 Region: 2746-2790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000666
Family EGF-type module 0.025
Further Details:      
 
Domain Number 62 Region: 11905-11928
Classification Level Classification E-value
Superfamily DPY module 0.0000745
Family DPY module 0.0015
Further Details:      
 
Domain Number 63 Region: 4772-4795
Classification Level Classification E-value
Superfamily DPY module 0.0000824
Family DPY module 0.0014
Further Details:      
 
Domain Number 64 Region: 8191-8214
Classification Level Classification E-value
Superfamily DPY module 0.0000876
Family DPY module 0.0017
Further Details:      
 
Domain Number 65 Region: 8296-8319
Classification Level Classification E-value
Superfamily DPY module 0.0000876
Family DPY module 0.0016
Further Details:      
 
Domain Number 66 Region: 12119-12142
Classification Level Classification E-value
Superfamily DPY module 0.0000876
Family DPY module 0.0021
Further Details:      
 
Weak hits

Sequence:  FBpp0304630
Domain Number - Region: 5194-5217
Classification Level Classification E-value
Superfamily DPY module 0.000101
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 7760-7783
Classification Level Classification E-value
Superfamily DPY module 0.000107
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 11266-11289
Classification Level Classification E-value
Superfamily DPY module 0.000111
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 10627-10650
Classification Level Classification E-value
Superfamily DPY module 0.000114
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 12864-12887
Classification Level Classification E-value
Superfamily DPY module 0.000118
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 10308-10331
Classification Level Classification E-value
Superfamily DPY module 0.00012
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 7552-7575
Classification Level Classification E-value
Superfamily DPY module 0.000122
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 5630-5653
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 16018-16040
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 1334-1479
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000148
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 4450-4472
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 6163-6186
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 4556-4579
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 10739-10762
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 12759-12782
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 9355-9378
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 8612-8635
Classification Level Classification E-value
Superfamily DPY module 0.000196
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 9571-9594
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 15926-15948
Classification Level Classification E-value
Superfamily DPY module 0.000235
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 7973-7996
Classification Level Classification E-value
Superfamily DPY module 0.000248
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 7232-7255
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 7658-7681
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 6393-6540
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000267
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 9037-9060
Classification Level Classification E-value
Superfamily DPY module 0.000288
Family DPY module 0.0011
Further Details:      
 
Domain Number - Region: 5304-5327
Classification Level Classification E-value
Superfamily DPY module 0.000301
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 12225-12248
Classification Level Classification E-value
Superfamily DPY module 0.000301
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 12544-12567
Classification Level Classification E-value
Superfamily DPY module 0.000301
Family DPY module 0.0026
Further Details:      
 
Domain Number - Region: 13508-13531
Classification Level Classification E-value
Superfamily DPY module 0.000314
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 6271-6294
Classification Level Classification E-value
Superfamily DPY module 0.00034
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 10852-11004
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000392
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number - Region: 12561-12715
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000392
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number - Region: 8398-8421
Classification Level Classification E-value
Superfamily DPY module 0.000471
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 7026-7181
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000534
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 7866-7889
Classification Level Classification E-value
Superfamily DPY module 0.000575
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 14970-15125
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000612
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number - Region: 5520-5543
Classification Level Classification E-value
Superfamily DPY module 0.000641
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 12014-12037
Classification Level Classification E-value
Superfamily DPY module 0.000654
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 2342-2501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00102
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 6803-6826
Classification Level Classification E-value
Superfamily DPY module 0.00105
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 7441-7464
Classification Level Classification E-value
Superfamily DPY module 0.00131
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 10205-10228
Classification Level Classification E-value
Superfamily DPY module 0.00131
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 10966-11113
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00133
Family Growth factor receptor domain 0.0074
Further Details:      
 
Domain Number - Region: 11340-11436
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00137
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 15619-15768
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00155
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 16465-16488
Classification Level Classification E-value
Superfamily DPY module 0.00157
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 10424-10580
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00165
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 13578-13612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00183
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 16595-16618
Classification Level Classification E-value
Superfamily DPY module 0.00183
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 13038-13072
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00184
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 4941-4975
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00192
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 12188-12220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00212
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 9951-9985
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00224
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 12934-12967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00229
Family Merozoite surface protein 1 (MSP-1) 0.061
Further Details:      
 
Domain Number - Region: 4236-4259
Classification Level Classification E-value
Superfamily DPY module 0.00235
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 13090-13247
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00251
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 16084-16107
Classification Level Classification E-value
Superfamily DPY module 0.00275
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 7195-7227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0028
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 12826-12859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00352
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 14923-14956
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00432
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 4732-4765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00469
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 9683-9838
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00502
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 15244-15277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00518
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 16206-16229
Classification Level Classification E-value
Superfamily DPY module 0.00589
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 2632-2795
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00628
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 13469-13503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00711
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 5202-5362
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00863
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 3916-3952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00937
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 15564-15597
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 6587-6610
Classification Level Classification E-value
Superfamily DPY module 0.011
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 12507-12539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0113
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 17241-17263
Classification Level Classification E-value
Superfamily DPY module 0.012
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 7772-7924
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0126
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 6124-6158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0139
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 4135-4156
Classification Level Classification E-value
Superfamily DPY module 0.0144
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 15602-15625
Classification Level Classification E-value
Superfamily DPY module 0.017
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 6656-6689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0176
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 1849-1885
Classification Level Classification E-value
Superfamily EGF/Laminin 0.021
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 10704-10800
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.022
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number - Region: 13701-13733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0227
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 11598-11751
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0251
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 14694-14728
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 8156-8253
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0267
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 12294-12327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0272
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 9848-9881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0288
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 15887-15919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 790-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0296
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 8621-8781
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0298
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 15139-15169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0315
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 8046-8144
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0345
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 6878-6908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0352
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 8793-8888
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0377
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 9000-9032
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0393
Family EGF-like domain of nidogen-1 0.051
Further Details:      
 
Domain Number - Region: 4197-4230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0402
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 5156-5189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0405
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 6233-6266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0418
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 7722-7755
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 16406-16427
Classification Level Classification E-value
Superfamily DPY module 0.0432
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 4048-4081
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0457
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 5372-5404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.046
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 17494-17516
Classification Level Classification E-value
Superfamily DPY module 0.0471
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 13806-13839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.049
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 7932-7967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0503
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 10378-10411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0503
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 15780-15808
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0509
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 17432-17452
Classification Level Classification E-value
Superfamily DPY module 0.051
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 8575-8606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0607
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 17315-17335
Classification Level Classification E-value
Superfamily DPY module 0.0628
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 4459-4615
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0722
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 16758-16801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.074
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 6016-6049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0749
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 3766-3925
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0832
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number - Region: 16988-17010
Classification Level Classification E-value
Superfamily DPY module 0.085
Family DPY module 0.0027
Further Details:      
 
Domain Number - Region: 2498-2519
Classification Level Classification E-value
Superfamily DPY module 0.0863
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 16148-16168
Classification Level Classification E-value
Superfamily DPY module 0.0968
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 4628-4659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.1
Family EGF-type module 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304630   Gene: FBgn0053196   Transcript: FBtr0332353
Sequence length 18095
Comment pep:known chromosome:BDGP5:2L:4479471:4595054:-1 gene:FBgn0053196 transcript:FBtr0332353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNE
STEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGY
GGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAAR
CVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP
DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD
ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGS
FQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQP
DGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFV
CTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACE
QVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNT
PGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAA
GCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKC
GAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPE
PNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAE
KAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCI
CRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEI
CNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSC
VDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAAN
EKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLL
GCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC
ASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGD
GALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVC
GIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPG
TFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK
PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQ
KGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICF
QLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEE
DKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNP
VVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCD
CLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAV
CVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEES
CGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKC
PPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVC
SCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNV
CVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCS
IDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAV
GERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIG
TPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCA
NNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHV
DCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQ
PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCE
RQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPC
SLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSP
LCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLS
DAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSN
DKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCG
PGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVC
AQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSV
CKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKE
CVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVC
LHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNP
TPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN
ECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCL
CPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRT
VCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVN
HGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKC
RNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTV
SEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCR
VVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAH
QGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRT
LGCEVGGCVRQGYEYVCQQEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFN
HQPLCSAEHGRTPGCEHCPPGANCDPTTGACIKVECTDDSDCGVTEACINQLCQHPCDVH
DPCATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCI
NPCQEDSCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKC
SSPCQCGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNP
ICYCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCEL
PSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAIC
DSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVG
DAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDA
DCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNP
CVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKCVDPC
AGAICGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCS
VYGDGVALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNV
YEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKG
YFGDPHIGCRPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYS
GDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECV
VSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPG
RDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKACI
NEKCQNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNP
CAENAVCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAAC
GANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPT
CSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSC
PANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCR
PECVINQDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMR
EIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRPECVQNSDCPNNR
ACINMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPC
RPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCPG
TCGYNARCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQ
CQVSSSGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGNNALCHV
SLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPE
YFGDPYVECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYT
GNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCR
PECMSSSECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQ
EKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECP
GNLACINLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQP
CNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPC
PGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREV
NGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHN
PICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNF
VGRAPNCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGD
PFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVV
NSDCSRDKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPP
PPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQN
QKCVDPCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPS
PCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACG
LHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNG
AGSCACLPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGP
NCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPP
SCKPECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGC
EPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHL
SCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPC
EPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVD
PCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNC
RAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHTCGIRAICTTK
NHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACS
CLPNFIGAPPRCRPECVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIE
GYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPEC
TLSADCPRDKACMRNRCVDPCPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVV
EDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNK
KCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVP
SPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPCPESC
GTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAAC
KCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVC
NDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNC
KPECTVNAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICSCPLDMTGDPFARCYP
APPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTD
CSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSP
PLTQDPCDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVD
PCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHIS
GQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHN
PSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIG
TPPSCRPECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPF
TGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRPECVRHS
DCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPAR
VTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTDKACISQ
RCQDPCPGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPS
PCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRPECTISAECPSNLACIRERCIDPCPGSCG
YAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNAQCNAGI
CTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGTCGENAICDVINHIPMCR
CPERTAGSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSCLPSFIGAPPSCRPE
CTSNSECAPTQACLNQRCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPFIRCQPQIE
PPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECVTSSDCSSQLA
CVNQKCVDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPS
PCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQDPCPGTC
GLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNE
QAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADTCGNNAICRVRNHSP
ICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLVN
FIGQAPNCRPECTINSECPSQLACINQKCRDPCPGACGQNAVCSVINHTPLCACIDGYIG
NPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLN
TDCPRDRACVRNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGNAFFECRPVPPAKIQ
NPCQPSPCGPNSQCRVVQQTAVCSCLANYVGSPPQCRPECVTNSDCPADQDCQNMKCRDP
CPGTCGFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGPNSECR
VSGDSPSCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPCPGLCGQNAICRVFS
HSAMCLCDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPCGVNAKCEERGGAGSCQCLPDYF
GNPYDGCRPECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLATCNCLVGYTGD
PYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTS
SSECAADKACVNRKCVDPCPNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPP
VVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCRPECSINAECPSHQACI
NQKCRDPCPGSCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPC
NPSPCGSNTQCNNGVCSCLPEYHGDPYTGCRPECVLHTDCDRSRACVRHKCVDPCPGTCG
TNAICEVLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAI
CSCITSFIGSPPFCRPECTTNSECPLNLACRNQKCSDPCPGVCGRGAQCHVTNHSPFCRC
LERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNC
RPECVTSSECPTNQACIQQKCRDPCPGLCGQSAECRVLSHTPSCVCPEGMEGDPFTLCKE
KRIQELDQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCRPECVLNSDCPSNK
ACQQQKCQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNPCQPSP
CGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCPNTCGD
QAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYSQCRSQ
GDAPACSCLVGYIGAPPNCRPECRINAECPSSQACINEKCRDPCPGSCGYGAICNVINHT
PSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDP
YSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFV
QCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSH
LACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQD
PCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPC
PGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQR
NGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNH
TPMCNCFAGFIGDPYRYCSQPPEPIVHEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFE
GAPPNCRPQCTSSSECASNRACINQKCVDPCPGVCGQQAICEVRNHSPICRCPTAMIGDP
FVRCIPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGTPPHCRP
ECSINAECPSHLACIGERCRDPCPGACGQQTECRVISHVPSCVCLRGYVGDAFLACHPAP
PPPSREEPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACRPECVLSSECPRNLACI
QQKCTDPCPGTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPVQLDVYRNPCNPSPCGS
YAECREQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQNQRCVDPCPGACGAYAE
CRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSC
SCLSNFFGTPPNCRPECVSNSECSQVHVCSNNRCKDPCPGLCGTDAVCRVISHSAMCYCQ
PGYSGDPFVRCAPHIQRESIEIVQPCNPNPCGAFAECRQQNGVGSCQCLPEYFGNPYEGC
RPECVLDSDCPSQLACVNQKCRDPCPGSCGQNAECFVRNHLPTCNCLSGYVGDPYRYCSI
EPKPIREYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTPPGCRPECTVSSECNLDKA
CVRHKCLDPCPGACGSSANCQVVNHAPLCSCQAGYTGDPFTRCYPIPSPPTHIVHDYARH
PCQPSPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSECLSSLACINQRCADPC
PGSCAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCNPSPCGANAV
CQNGQCSCIPEYQGDPYTGCRPECVLNADCPRNRACVRHKCVDPCPGTCAPNAICDVINH
IAMCRCPERMTGNAFIQCETPPVSLAPPDPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGT
PPNCRPECTHNSDCLPRLACQRQHCIDPCPGTCGFNALCHVVNHAPICSCPPKHNGNPFL
GCFPEPVRRDEVIPKNPCQPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNCRPECITNSE
CSFDKACLNQRCRDPCSGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPVIQQAEI
VQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCRPECVTNNDCPSNKACQQQKCR
DPCPGVCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNS
QCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCR
VIQHAPICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATC
SCLPSYFGTPPNCRPECTINPDCPSHLSCQQQRCRDPCPGACGFNALCTVINHNPTCQCA
PGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQCNCLPEFVGNPLVGCRP
ECVLSTECDWSKACVRNKCIDPCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLP
PAPVRDVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGVPPSCRPECVSNAECPLHLAC
LQRHCRDPCPGVCGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPPIKHEPIDPCQP
SPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRDPCPGVC
GSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCGANALCSEGNGAG
ACKCLPEFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQC
NCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSP
PACRPECTISSECDLTLACVQQHCVDPCPGVCGNSAQCRVINHSPHCSCLPGFTGDAISG
CQRIPPAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAPPNCRPECAI
NPDCASHLACISEKCRDPCPGSCGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPT
PPLHDACNPSPCGSNAICSPGGQCSCLPDFDGNPYVGCRPECVLNTDCARDKACQRSKCT
DPCPGACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTLVQSSPVVPLNPCQPSPCGNNAQ
CREVNDQAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQCRDPCPGACGQFAQCQV
IRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCGPNAECTNQNEQAICKC
LKDYIGTPPNCRPECITSSECPIQLACIGQKCKDPCSGLCGIAATCQVVSHVPSCICIAD
YIGDPYTGCYARPPIQREQINPCYQNPCGSNAVCRERGEAASCQCLPEYYGNPYEGCRPE
CVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQA
EPVQVVHFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRPECTTNPECPNDKAC
VSRRCTDPCAGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRD
PCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRPECTQNSDCPSHRACVNQRCVDPC
PGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPN
AQCSNGVCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVH
NHVAMCQCPVGYQGNPFVLCQQTPLQAPVELHPCQPSPCGHHGECREVGSQAICTCRLGY
YGSPPACRPECVSDPECPPSLACVNQKCRDPCPGACGHLAQCHVINHSPQCVCPAGYTGS
PYSECHLIRADSSPIQRQPIDPCLPSPCGPHAQCSNEGGNAVCRCLTEYLGVPPYCRPEC
IANSECPSDRACINRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRP
EIPATPPTTAIQVLQYEEPFINGCEPNPCGANAQCNQRRGVVSCVCLPDYFGNPYEACRP
ECILNSDCPLSRACVQQKCRDPCPGTCGLNAECHVMDHLPQCRCFSGYTGNPLAYCSPVP
IIQESPLTPCDPSPCGPNAQCHPSLNEAVCSCLPEFYGTPPNCRPECTLNSECAYDKACV
HHKCVDPCPGICGINADCRVHYHSPICYCISSHTGDPFTRCYETPKPVRPQIYDTPSPPY
PVAIPDLVYVQQQQPGIVNIPSAPQPIYPTPQSPQYNVNYPSPQPANPQKPGVVNIPSVP
QPVYPSPQPPVYDVNYPTTPVSQHPGVVNIPSAPRLVPPTSQRPVFITSPGNLSPTPQPG
VINIPSVSQPGYPTPQSPIYDANYPTTQSPIPQQPGVVNIPSVPSPSYPAPNPPVNYPTQ
PSPQIPVQPGVINIPSAPLPTTPPQHPPVFIPSPESPSPAPKPGVINIPSVTHPEYPTSQ
VPVYDVNYSTTPSPIPQKPGVVNIPSAPQPVHPAPNPPVHEFNYPTPPAVPQQPGVLNIP
SYPTPVAPTPQSPIYIPSQEQPKPTTRPSVINVPSVPQPAYPTPQAPVYDVNYPTSPSVI
PHQPGVVNIPSVPLPAPPVKQRPVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTYQPPVVE
RPAIYDVYYPPPPSRPGVINIPSPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHNIPSVPQ
PTYPHRNPPIQDVTYPAPQPSPPVPGIVNIPSLPQPVSTPTSGVINIPSQASPPISVPTP
GIVNIPSIPQPTPQRPSPGIINVPSVPQPIPTAPSPGIINIPSVPQPLPSPTPGVINIPQ
QPTPPPLVQQPGIINIPSVQQPSTPTTQHPIQDVQYETQRPQPTPGVINIPSVSQPTYPT
QKPSYQDTSYPTVQPKPPVSGIINIPSVPQPVPSLTPGVINLPSEPSYSAPIPKPGIINV
PSIPEPIPSIPQNPVQEVYHDTQKPQAIPGVVNVPSAPQPTPGRPYYDVAKPDFEFNPCY
PSPCGPYSHCHNRFGVAACVCLPNYRGTPPNCRPECVINSDCPSSLACINEKCRDPCPGS
CAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVC
NNGKCSCIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPGTCGLQALCHVYNHV
ATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRA
YHEQAICYCLPNFIGTPPGCRPECTSNSDCPLDKYCLNLRCRDPCPGACGIRAICHVQNH
GPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQY
HGTPPFCRPECVNSADCPADKACRNYKCIDPCPGSCGFSALCRVVAHSPVCYCPEGYVGN
AYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTV
NSDCPSHRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQREPP
APEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQ
KCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPS
PCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGACG
FAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQC
SCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHC
PERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPN
CRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCN
PIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECAN
TLACMNQKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTP
KNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKC
QDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSI
CRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGECGFGAVC
QTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPEC
VINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPE
PEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNAL
QNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNP
LVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVR
CDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCL
PGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHR
AICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAEC
RVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGA
QCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCAL
NAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCA
TPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTE
VCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGC
SRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSD
VILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAP
IGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCL
RLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAY
CEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAE
YEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCS
CQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQC
RCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAV
CRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTP
TSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCNCGL
NAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQCGS
NAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCA
QDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNAT
QPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPP
GTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQ
PEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGNP
DLHCNHTNFRTDFPRPDMVVSCLADGVQVEIHITEPGFNGVLYVKGHSKDEECRRVVNLA
GETVPRTEIFRVHFGSCGMQAVKDVASFVLVIQKHPKLVTYKAQAYNIKCVYQTGEKNVT
LGFNVSMLTTAGTIANTGPPPICQMRIITNEGEEINSAEIGDNLKLQVDVEPATIYGGFA
RSCIAKTMEDNVQNEYLVTDENGCATDTSIFGNWEYNPDTNSLLASFNAFKFPSSDNIRF
QCNIRVCFGRCQPVNCGGYNAFGRRRRSIADNSTDATAIATNSGVEGQLREEITISSNAI
LTFEKRSGQGLNDANIKPAAQRVEDICVSMVGLIIALVITALLALVAVAVAVSCWLMAYR
RRPKTIAPLPHPPEFPNPLFSNPDAVPEPTPDYIS
Download sequence
Identical sequences M9PC48
NP_001260040.1.81976 FBpp0304630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]