SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304631 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304631
Domain Number 1 Region: 264-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000989
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 2 Region: 181-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000298
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 623-760
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000298
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 4 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000111
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 2389-2433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000127
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 6 Region: 492-625
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000361
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 2221-2259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000375
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 454-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000552
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 1334-1473
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000107
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 408-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000191
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 9248-9271
Classification Level Classification E-value
Superfamily DPY module 0.00000327
Family DPY module 0.00058
Further Details:      
 
Domain Number 12 Region: 13398-13421
Classification Level Classification E-value
Superfamily DPY module 0.00000353
Family DPY module 0.00085
Further Details:      
 
Domain Number 13 Region: 5410-5433
Classification Level Classification E-value
Superfamily DPY module 0.00000562
Family DPY module 0.001
Further Details:      
 
Domain Number 14 Region: 9142-9165
Classification Level Classification E-value
Superfamily DPY module 0.00000628
Family DPY module 0.00098
Further Details:      
 
Domain Number 15 Region: 12332-12355
Classification Level Classification E-value
Superfamily DPY module 0.00000628
Family DPY module 0.00093
Further Details:      
 
Domain Number 16 Region: 958-1070
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000675
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 17 Region: 8829-8852
Classification Level Classification E-value
Superfamily DPY module 0.00000811
Family DPY module 0.001
Further Details:      
 
Domain Number 18 Region: 5745-5899
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000879
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 19 Region: 10416-10439
Classification Level Classification E-value
Superfamily DPY module 0.0000105
Family DPY module 0.00091
Further Details:      
 
Domain Number 20 Region: 13193-13353
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000126
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 21 Region: 10844-10867
Classification Level Classification E-value
Superfamily DPY module 0.0000127
Family DPY module 0.0012
Further Details:      
 
Domain Number 22 Region: 9990-10013
Classification Level Classification E-value
Superfamily DPY module 0.0000131
Family DPY module 0.0013
Further Details:      
 
Domain Number 23 Region: 11161-11184
Classification Level Classification E-value
Superfamily DPY module 0.0000131
Family DPY module 0.00087
Further Details:      
 
Domain Number 24 Region: 826-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000144
Family EGF-type module 0.012
Further Details:      
 
Domain Number 25 Region: 6483-6506
Classification Level Classification E-value
Superfamily DPY module 0.0000144
Family DPY module 0.0011
Further Details:      
 
Domain Number 26 Region: 9887-9910
Classification Level Classification E-value
Superfamily DPY module 0.0000144
Family DPY module 0.00091
Further Details:      
 
Domain Number 27 Region: 10521-10544
Classification Level Classification E-value
Superfamily DPY module 0.0000144
Family DPY module 0.00083
Further Details:      
 
Domain Number 28 Region: 12437-12460
Classification Level Classification E-value
Superfamily DPY module 0.0000144
Family DPY module 0.00093
Further Details:      
 
Domain Number 29 Region: 9781-9804
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.001
Further Details:      
 
Domain Number 30 Region: 5087-5110
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.00089
Further Details:      
 
Domain Number 31 Region: 11692-11715
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.0014
Further Details:      
 
Domain Number 32 Region: 4980-5003
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.001
Further Details:      
 
Domain Number 33 Region: 8934-8957
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.0013
Further Details:      
 
Domain Number 34 Region: 5948-5971
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.0012
Further Details:      
 
Domain Number 35 Region: 6055-6078
Classification Level Classification E-value
Superfamily DPY module 0.0000235
Family DPY module 0.0013
Further Details:      
 
Domain Number 36 Region: 11481-11504
Classification Level Classification E-value
Superfamily DPY module 0.0000235
Family DPY module 0.0011
Further Details:      
 
Domain Number 37 Region: 9464-9487
Classification Level Classification E-value
Superfamily DPY module 0.0000248
Family DPY module 0.00093
Further Details:      
 
Domain Number 38 Region: 13078-13101
Classification Level Classification E-value
Superfamily DPY module 0.0000262
Family DPY module 0.0011
Further Details:      
 
Domain Number 39 Region: 8082-8105
Classification Level Classification E-value
Superfamily DPY module 0.0000275
Family DPY module 0.0013
Further Details:      
 
Domain Number 40 Region: 8718-8741
Classification Level Classification E-value
Superfamily DPY module 0.0000275
Family DPY module 0.0015
Further Details:      
 
Domain Number 41 Region: 915-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000288
Family EGF-type module 0.017
Further Details:      
 
Domain Number 42 Region: 4664-4687
Classification Level Classification E-value
Superfamily DPY module 0.0000327
Family DPY module 0.0013
Further Details:      
 
Domain Number 43 Region: 8506-8529
Classification Level Classification E-value
Superfamily DPY module 0.0000327
Family DPY module 0.0014
Further Details:      
 
Domain Number 44 Region: 4344-4367
Classification Level Classification E-value
Superfamily DPY module 0.0000392
Family DPY module 0.0015
Further Details:      
 
Domain Number 45 Region: 4875-4898
Classification Level Classification E-value
Superfamily DPY module 0.0000392
Family DPY module 0.0017
Further Details:      
 
Domain Number 46 Region: 12972-12995
Classification Level Classification E-value
Superfamily DPY module 0.0000405
Family DPY module 0.0016
Further Details:      
 
Domain Number 47 Region: 13723-13746
Classification Level Classification E-value
Superfamily DPY module 0.0000445
Family DPY module 0.0011
Further Details:      
 
Domain Number 48 Region: 6913-6936
Classification Level Classification E-value
Superfamily DPY module 0.0000471
Family DPY module 0.0012
Further Details:      
 
Domain Number 49 Region: 9675-9698
Classification Level Classification E-value
Superfamily DPY module 0.0000471
Family DPY module 0.0014
Further Details:      
 
Domain Number 50 Region: 7335-7358
Classification Level Classification E-value
Superfamily DPY module 0.0000484
Family DPY module 0.0013
Further Details:      
 
Domain Number 51 Region: 2746-2790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000503
Family EGF-type module 0.025
Further Details:      
 
Domain Number 52 Region: 11799-11822
Classification Level Classification E-value
Superfamily DPY module 0.0000549
Family DPY module 0.001
Further Details:      
 
Domain Number 53 Region: 11905-11928
Classification Level Classification E-value
Superfamily DPY module 0.0000641
Family DPY module 0.0015
Further Details:      
 
Domain Number 54 Region: 4772-4795
Classification Level Classification E-value
Superfamily DPY module 0.0000719
Family DPY module 0.0014
Further Details:      
 
Domain Number 55 Region: 8191-8214
Classification Level Classification E-value
Superfamily DPY module 0.0000759
Family DPY module 0.0017
Further Details:      
 
Domain Number 56 Region: 8296-8319
Classification Level Classification E-value
Superfamily DPY module 0.0000759
Family DPY module 0.0016
Further Details:      
 
Domain Number 57 Region: 12119-12142
Classification Level Classification E-value
Superfamily DPY module 0.0000759
Family DPY module 0.0021
Further Details:      
 
Domain Number 58 Region: 5194-5217
Classification Level Classification E-value
Superfamily DPY module 0.0000876
Family DPY module 0.0014
Further Details:      
 
Domain Number 59 Region: 7760-7783
Classification Level Classification E-value
Superfamily DPY module 0.0000929
Family DPY module 0.002
Further Details:      
 
Domain Number 60 Region: 12561-12714
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000957
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number 61 Region: 11266-11289
Classification Level Classification E-value
Superfamily DPY module 0.0000968
Family DPY module 0.0023
Further Details:      
 
Domain Number 62 Region: 10627-10650
Classification Level Classification E-value
Superfamily DPY module 0.0000994
Family DPY module 0.0015
Further Details:      
 
Domain Number 63 Region: 1141-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0001
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0304631
Domain Number - Region: 12864-12887
Classification Level Classification E-value
Superfamily DPY module 0.000102
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 10308-10331
Classification Level Classification E-value
Superfamily DPY module 0.000105
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 7552-7575
Classification Level Classification E-value
Superfamily DPY module 0.000106
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 7017-7040
Classification Level Classification E-value
Superfamily DPY module 0.000116
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 5630-5653
Classification Level Classification E-value
Superfamily DPY module 0.000118
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 13921-13943
Classification Level Classification E-value
Superfamily DPY module 0.00012
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 7122-7145
Classification Level Classification E-value
Superfamily DPY module 0.000126
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 4450-4472
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 6163-6186
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 10739-10762
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 4556-4579
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 9355-9378
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 12759-12782
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 8612-8635
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 9571-9594
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 13829-13851
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 7658-7681
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 7973-7996
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 7232-7255
Classification Level Classification E-value
Superfamily DPY module 0.000235
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 5304-5327
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 9037-9060
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0011
Further Details:      
 
Domain Number - Region: 12225-12248
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 12544-12567
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0026
Further Details:      
 
Domain Number - Region: 13612-13635
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 10852-11005
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000282
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number - Region: 12826-12859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000282
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 6271-6294
Classification Level Classification E-value
Superfamily DPY module 0.000288
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 10064-10163
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000377
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 8398-8421
Classification Level Classification E-value
Superfamily DPY module 0.000405
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 7866-7889
Classification Level Classification E-value
Superfamily DPY module 0.00051
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 5520-5543
Classification Level Classification E-value
Superfamily DPY module 0.000562
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 12014-12037
Classification Level Classification E-value
Superfamily DPY module 0.000562
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 6803-6826
Classification Level Classification E-value
Superfamily DPY module 0.000915
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 6233-6266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00105
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 10966-11113
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0011
Family Growth factor receptor domain 0.0074
Further Details:      
 
Domain Number - Region: 7441-7464
Classification Level Classification E-value
Superfamily DPY module 0.00118
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 11340-11436
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00119
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 10205-10228
Classification Level Classification E-value
Superfamily DPY module 0.00119
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 6393-6541
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0013
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 14368-14391
Classification Level Classification E-value
Superfamily DPY module 0.00144
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 10424-10580
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00149
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 14498-14521
Classification Level Classification E-value
Superfamily DPY module 0.00157
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 4941-4975
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00165
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 2632-2795
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00173
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 7085-7117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00173
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 12934-12967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00195
Family Merozoite surface protein 1 (MSP-1) 0.061
Further Details:      
 
Domain Number - Region: 4236-4259
Classification Level Classification E-value
Superfamily DPY module 0.00196
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 7195-7227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00234
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 11585-11608
Classification Level Classification E-value
Superfamily DPY module 0.00235
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 13987-14010
Classification Level Classification E-value
Superfamily DPY module 0.00235
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 2342-2501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00267
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 12188-12220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00291
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 11866-11900
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00321
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 13038-13072
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00412
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 9953-10049
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00439
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 9683-9838
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00447
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 13147-13180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00455
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 4732-4765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00457
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 14109-14132
Classification Level Classification E-value
Superfamily DPY module 0.0051
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 5202-5362
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00698
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 13520-13671
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00738
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 5956-6113
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00785
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number - Region: 3916-3952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00815
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 12507-12539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 13467-13500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00935
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 6587-6610
Classification Level Classification E-value
Superfamily DPY module 0.00955
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 15144-15166
Classification Level Classification E-value
Superfamily DPY module 0.0105
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 6124-6158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0116
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 8621-8781
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0118
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 790-839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.012
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 4135-4156
Classification Level Classification E-value
Superfamily DPY module 0.012
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 12294-12327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0128
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 13505-13528
Classification Level Classification E-value
Superfamily DPY module 0.0144
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 6656-6689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0147
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 10704-10800
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0188
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number - Region: 8156-8252
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.022
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 7772-7925
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0235
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 9848-9881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0241
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 4197-4230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0262
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 8046-8144
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0267
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 13790-13822
Classification Level Classification E-value
Superfamily EGF/Laminin 0.027
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 6878-6908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0298
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 11598-11751
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0314
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 5156-5189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 6717-6861
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0345
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 7722-7755
Classification Level Classification E-value
Superfamily EGF/Laminin 0.036
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 14309-14330
Classification Level Classification E-value
Superfamily DPY module 0.0379
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 7932-7967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0404
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 15397-15419
Classification Level Classification E-value
Superfamily DPY module 0.0405
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 13683-13711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 4048-4081
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0431
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 10378-10411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0433
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 15335-15355
Classification Level Classification E-value
Superfamily DPY module 0.0445
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 8575-8606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0531
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 15218-15238
Classification Level Classification E-value
Superfamily DPY module 0.0549
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 1827-1946
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0628
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 3766-3925
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0659
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number - Region: 14661-14704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0695
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 14891-14913
Classification Level Classification E-value
Superfamily DPY module 0.0745
Family DPY module 0.0027
Further Details:      
 
Domain Number - Region: 2498-2519
Classification Level Classification E-value
Superfamily DPY module 0.0759
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 11548-11580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0812
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 14051-14071
Classification Level Classification E-value
Superfamily DPY module 0.0837
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 4628-4659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0865
Family EGF-type module 0.084
Further Details:      
 
Domain Number - Region: 9426-9459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0984
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 8793-8888
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0989
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304631   Gene: FBgn0053196   Transcript: FBtr0332354
Sequence length 15998
Comment pep:known chromosome:BDGP5:2L:4477462:4591963:-1 gene:FBgn0053196 transcript:FBtr0332354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNE
STEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGY
GGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAAR
CVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP
DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD
ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGS
FQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQP
DGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFV
CTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACE
QVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNT
PGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAA
GCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKC
GAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPE
PNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAE
KAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCI
CRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEI
CNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSC
VDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAAN
EKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLL
GCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC
ASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGD
GALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVC
GIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPG
TFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK
PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQ
KGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICF
QLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEE
DKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNP
VVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCD
CLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAV
CVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEES
CGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKC
PPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVC
SCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNV
CVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCS
IDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAV
GERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIG
TPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCA
NNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHV
DCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQ
PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCE
RQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPC
SLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSP
LCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLS
DAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSN
DKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCG
PGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVC
AQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSV
CKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKE
CVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVC
LHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNP
TPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN
ECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCL
CPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRT
VCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVN
HGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKC
RNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTV
SEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCR
VVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAH
QGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRT
LGCEVGGCVRQGYEYVCQQEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFN
HQPLCSAEHGRTPGCEHCPPGANCDPTTGACIKVECTDDSDCGVTEACINQLCQHPCDVH
DPCATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCI
NPCQEDSCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKC
SSPCQCGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNP
ICYCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCEL
PSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAIC
DSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVG
DAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDA
DCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNP
CVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKCVDPC
AGAICGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCS
VYGDGVALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNV
YEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKG
YFGDPHIGCRPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYS
GDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECV
VSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPG
RDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKACI
NEKCQNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNP
CAENAVCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAAC
GANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPT
CSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSC
PANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCR
PECVINQDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMR
EIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRPECVQNSDCPNNR
ACINMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPC
RPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCPG
TCGYNARCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQ
CQVSSSGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGNNALCHV
SLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPE
YFGDPYVECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYT
GNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCR
PECMSSSECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQ
EKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECP
GNLACINLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQP
CNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPC
PGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREV
NGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHN
PICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNF
VGRAPNCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGD
PFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVV
NSDCSRDKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPP
PPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQN
QKCVDPCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPS
PCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACG
LHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNG
AGSCACLPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGP
NCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPP
SCKPECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGC
EPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHL
SCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPC
EPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVD
PCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNC
RAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHTCGIRAICTTK
NHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACS
CLPNFIGAPPRCRPECVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIE
GYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPEC
TLSADCPRDKACMRNRCVDPCPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVV
EDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNK
KCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVP
SPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPCPESC
GTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAAC
KCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVC
NDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNC
KPECTVNAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICSCPLDMTGDPFARCYP
APPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTD
CSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSP
PLTQDPCDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVD
PCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHIS
GQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHN
PSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIG
TPPSCRPECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPF
TGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRPECVRHS
DCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPAR
VTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTDKACISQ
RCQDPCPGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPS
PCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRPECTISAECPSNLACIRERCIDPCPGSCG
YAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNAQCNAGI
CTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGTCGENAICDVINHIPMCR
CPERTAGSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSCLPSFIGAPPSCRPE
CTSNSECAPTQACLNQRCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPFIRCQPQIE
PPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECVTSSDCSSQLA
CVNQKCVDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPS
PCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQDPCPGTC
GLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNE
QAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADTCGNNAICRVRNHSP
ICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLVN
FIGQAPNCRPECTINSECPSQLACINQKCRDPCPGACGQNAVCSVINHTPLCACIDGYIG
NPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLN
TDCPRDRACVRNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGNAFFECRPVPPAKIQ
NPCQPSPCGPNSQCRVVQQTAVCSCLANYVGSPPQCRPECVTNSDCPADQDCQNMKCRDP
CPGTCGFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGPNSECR
VSGDSPSCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPCPGLCGQNAICRVFS
HSAMCLCDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPCGVNAKCEERGGAGSCQCLPDYF
GNPYDGCRPECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLATCNCLVGYTGD
PYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTS
SSECAADKACVNRKCVDPCPNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPP
VVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCRPECSINAECPSHQACI
NQKCRDPCPGSCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPC
NPSPCGSNTQCNNGVCSCLPEYHGDPYTGCRPECVLHTDCDRSRACVRHKCVDPCPGTCG
TNAICEVLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAI
CSCITSFIGSPPFCRPECTTNSECPLNLACRNQKCSDPCPGVCGRGAQCHVTNHSPFCRC
LERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNC
RPECVTSSECPTNQACIQQKCRDPCPGLCGQSAECRVLSHTPSCVCPEGMEGDPFTLCKE
KRIQELDQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCRPECVLNSDCPSNK
ACQQQKCQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNPCQPSP
CGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCPNTCGD
QAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYSQCRSQ
GDAPACSCLVGYIGAPPNCRPECRINAECPSSQACINEKCRDPCPGSCGYGAICNVINHT
PSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDP
YSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFV
QCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSH
LACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQD
PCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPC
PGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQR
NGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNH
TPMCNCFAGFIGDPYRYCSQPPEPIVHEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFE
GAPPNCRPQCTSSSECASNRACINQKCVDPCPGVCGQQAICEVRNHSPICRCPTAMIGDP
FVRCIPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGTPPHCRP
ECSINAECPSHLACIGERCRDPCPGACGQQTECRVISHVPSCVCLRGYVGDAFLACHPAP
PPPSREEPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACRPECVLSSECPRNLACI
QQKCTDPCPGTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPVQLDVYRNPCNPSPCGS
YAECREQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQNQRCVDPCPGACGAYAE
CRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSC
SCLSNFFGTPPNCRPECVSNSECSQVHVCSNNRCKDPCPGLCGTDAVCRVISHSAMCYCQ
PGYSGDPFVRCAPHIQRESIEIVQPCNPNPCGAFAECRQQNGVGSCQCLPEYFGNPYEGC
RPECVLDSDCPSQLACVNQKCRDPCPGSCGQNAECFVRNHLPTCNCLSGYVGDPYRYCSI
EPKPIREYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTPPGCRPECTVSSECNLDKA
CVRHKCLDPCPGACGSSANCQVVNHAPLCSCQAGYTGDPFTRCYPIPSPPTHIVHDYARH
PCQPSPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSECLSSLACINQRCADPC
PGSCAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCNPSPCGANAV
CQNGQCSCIPEYQGDPYTGCRPECVLNADCPRNRACVRHKCVDPCPGTCAPNAICDVINH
IAMCRCPERMTGNAFIQCETPPVSLAPPDPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGT
PPNCRPECTHNSDCLPRLACQRQHCIDPCPGTCGFNALCHVVNHAPICSCPPKHNGNPFL
GCFPEPVRRDEVIPKNPCQPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNCRPECITNSE
CSFDKACLNQRCRDPCSGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPVIQQAEI
VQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCRPECVTNNDCPSNKACQQQKCR
DPCPGVCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNS
QCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCR
VIQHAPICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATC
SCLPSYFGTPPNCRPECTINPDCPSHLSCQQQRCRDPCPGACGFNALCTVINHNPTCQCA
PGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQCNCLPEFVGNPLVGCRP
ECVLSTECDWSKACVRNKCIDPCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLP
PAPVRDVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGVPPSCRPECVSNAECPLHLAC
LQRHCRDPCPGVCGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPPIKHEPIDPCQP
SPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRDPCPGVC
GSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCGANALCSEGNGAG
ACKCLPEFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQC
NCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSP
PACRPECTISSECDLTLACVQQHCVDPCPGVCGNSAQCRVINHSPHCSCLPGFTGDAISG
CQRIPPAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAPPNCRPECAI
NPDCASHLACISEKCRDPCPGSCGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPT
PPLHDACNPSPCGSNAICSPGGQCSCLPDFDGNPYVGCRPECVLNTDCARDKACQRSKCT
DPCPGACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTLVQSSPVVPLNPCQPSPCGNNAQ
CREVNDQAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQCRDPCPGACGQFAQCQV
IRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCGPNAECTNQNEQAICKC
LKDYIGTPPNCRPECITSSECPIQLACIGQKCKDPCSGLCGIAATCQVVSHVPSCICIAD
YIGDPYTGCYARPPIQREQINPCYQNPCGSNAVCRERGEAASCQCLPEYYGNPYEGCRPE
CVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQA
EPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRAC
INQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPC
VPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPG
ACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNN
GQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAM
CHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQ
PPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFV
QCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDE
CANTLACMNQKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPP
PTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIR
SKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGP
NSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGECGFG
AVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSY
PECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQ
LPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTG
NALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYR
GNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNP
AVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMC
SCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQ
QHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGN
AECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCG
NGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQET
CALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCAD
PCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECA
NTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPN
PGCSRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLP
PSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFG
CAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFV
RCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNP
YAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCE
CAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRA
VCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNR
AQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNH
LAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICE
VTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCRDPCN
CGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQ
CGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTA
LCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNPC
NATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCV
CPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRG
ECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYT
GNPDLHCNHTNFRTDFPRPDMVVSCLADGVQVEIHITEPGFNGVLYVKGHSKDEECRRVV
NLAGETVPRTEIFRVHFGSCGMQAVKDVASFVLVIQKHPKLVTYKAQAYNIKCVYQTGEK
NVTLGFNVSMLTTAGTIANTGPPPICQMRIITNEGEEINSAEIGDNLKLQVDVEPATIYG
GFARSCIAKTMEDNVQNEYLVTDENGCATDTSIFGNWEYNPDTNSLLASFNAFKFPSSDN
IRFQCNIRVCFGRCQPVNCGGYNAFGRRRRSIADNSTDATAIATNSGVEGQLREEITISS
NAILTFEKRSGQGLNDANIKPAAQRVEDICVSMVGLIIALVITALLALVAVAVAVSCWLM
AYRRRPKTIAPLPHPPEFPNPLFSNPDAVPEPTPDYIS
Download sequence
Identical sequences M9PEI7
FBpp0304631 NP_001260041.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]