SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304662 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304662
Domain Number 1 Region: 1006-1182
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.93e-31
Family G proteins 0.00031
Further Details:      
 
Weak hits

Sequence:  FBpp0304662
Domain Number - Region: 568-644
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00361
Family FCH domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304662   Gene: FBgn0260658   Transcript: FBtr0332388
Sequence length 1417
Comment pep:known chromosome:BDGP5:X:3785530:3824611:-1 gene:FBgn0260658 transcript:FBtr0332388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKLEARGQFPASFPDTFKNFFAMMNEDEDHVGLFANLLEDKVIPRQNSPVQPQRQRYG
GSMRSHSGGDRSDRRGRTERQYQQQIQNHHHHHQQQQQQQQQHQQQQQHQGAQQRVFQSR
SRSGSGSSVDLYANRNVSFSTTTNRVNSLRRNRSRGSLTTLSSNGLNALGLGPVTLAPNV
SSSSSGSVLDLTLPGGTGTGTVDGGGGGGGGGAGCGGQNVYPSPAKSNLKPALKATNSSV
DRGCALFVGVDGEFHCGHIKYCSLHHDNFADGLQQLQQQLKNQQLGSGQKHVTMACCECV
CGSGKAARSGPDGEDNCGANYLKGYSGGYMLPPTPKGKSIDKTSTFTSAELAASKNKDLQ
ERQERQEKRGSVILERAFDFDASCDESDSISSSTHNPVPSPAPHQLAYNVLKPILKQPQQ
QQQQKAMLQAQHQQVNVQQHQGVTQQQYQQATHQQLGNQQHQVVTHQPHQQVTHQQHPGG
GVHQQHQVMVAHQAHAHTQVSNQQPVLQVQLPTPGVHVVHRLLPTPPTHSGKGAYHTRET
ALQRVQQQSGYYNQGPSTSASAYGYNQAMEQQQMQQQLHYDPHQELQFEQHQPHQSHQQQ
QLQHQQQHQLQHQQQHQQQQQYQQQQHQQQQHQQYADDTELDYDTEWELDEEPAPQIVPP
LTTFNDFVNAAQNPTGSRQSLRAQKSPILNRRRASSIAGNLLHSDYTYTRNSIGGAPIDS
NDFQRISHSSSARDRMSLAGVLTFQQAISGAVSPQYGTVGSLNSQVPATGEAGKPGIVGS
DGIGGGGGGLPGGSSHNLNLTVGLGFLGGSSTTLAAVAEVTSGPDGNGDSTDSPSPVSMI
PSNQQKQQQQLLQLQLQQEQQHLPTHLPMKRERGVGESSGASTSGTAIAELASSVVLATQ
SGKPMTERQRLRTSSMPAESRRPRLAEMRRSAIHAGDPDMTYYRLRSFSITSHGICNLGD
SLRSRRSRSINSVTSTGTSNSGVDRHNSNASGASGEVIDGDPNVPAYKIAMLGASGVGKT
TLTYQFTTSDYICAYDLSLDDDYGQKTVSVLVDNIETDLEIIDHPACEMSTEAFCATYNI
DLFVVVYSVIDRNTFAAAERVLQYLKENEMLLSRGAILVANKTDLQRHRVVTRQMGRKVA
KEIACKFIETSSGLDHNVDELLVGIVAQVKLNPQRLRLLTELELQRLNLQSTIQKHRGMH
LQTRRMVRQMSVCQGDEEIFDGGLPEGLQNGEANDDPDGVPSTSKASRSRIENPNRKPLN
LESILKMGESEVDEDEDVVKSSQLSKFNMLAASIRHRRPFRKRRSFDGGVTTSAAADAAA
ELQRRYQLRAMDDLQLEGRLAGATEERFGERSGLADSDDEEDGEDIVNGGHRNACNRKVV
KKLTARTKVFISSVLRFKKAISLKRRNSSSCSDLFVI
Download sequence
Identical sequences M9PGL8
FBpp0304662 NP_001259224.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]