SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304663 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304663
Domain Number 1 Region: 988-1164
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.93e-31
Family G proteins 0.00031
Further Details:      
 
Weak hits

Sequence:  FBpp0304663
Domain Number - Region: 550-626
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00351
Family FCH domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304663   Gene: FBgn0260658   Transcript: FBtr0332389
Sequence length 1399
Comment pep:known chromosome:BDGP5:X:3786417:3824611:-1 gene:FBgn0260658 transcript:FBtr0332389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKLEARGQFPASFPDTFKNFFAMMNEDEDHVGLFANLLEDKVIPRQNSPVQPQRQRYG
GSMRSHSGGDRSDRRGRTERQYQQQIQNHHHHHQQQQQQQQQHQQQQQHQGAQQQRVFQS
RSRSGSGSSVDLYANRNVSFSTTTNRVNSLRRNRSRGSLTTLSSNGLNALGLGPVTLAPN
VSSSSSGSVLDLTLPGGTGTGTVDGGGGGGGGGAGCGGQNVYPSPAKSNLKPALKATNSS
VDRGCALFVGVDDGLQQLQQQLKNQQLGSGQKHVTMACCECVCGSGKAARSGPDGEDNCG
ANYLKGYSGGYMLPPTPKGKSIDKTSTFTSAELAASKNKDLQERQERQEKRGSVILERAF
DFDASCDESDSISSSTHNPVPSPAPHQLAYNVLKPILKQPQQQQQQKAMLQAQHQQVNVQ
QHQGVTQQQYQQATHQQLGNQQHQVVTHQPHQQVTHQQHPGGGVHQQHQVMVAHQAHAHT
QVSNQQPVLQVQLPTPGVHVVHRLLPTPPTHSGKGAYHTRETALQRVQQQSGYYNQGPST
SASAYGYNQAMEQQQMQQQLHYDPHQELQFEQHQPHQSHQQQQLQHQQQHQLQHQQQHQQ
QQQYQQQQHQQQQHQQYADDTELDYDTEWELDEEPAPQIVPPLTTFNDFVNAAQNPTGSR
QSLRAQKSPILNRRRASSIAGNLLHSDYTYTRNSIGGAPIDSNDFQRISHSSSARDRMSL
AGVLTFQQAISGAVSPQYGTVGSLNSQVPATGEAGKPGIVGSDGIGGGGGGLPGGSSHNL
NLTVGLGFLGGSSTTLAAVAEVTSGPDGNGDSTDSPSPVSMIPSNQQKQQQQLLQLQLQQ
EQQHLPTHLPMKRERGVGESSGASTSGTAIAELASSVVLATQSGKPMTERQRLRTSSMPA
ESRRPRLAEMRRSAIHAGDPDMTYYRLRSFSITSHGICNLGDSLRSRRSRSINSVTSTGT
SNSGVDRHNSNASGASGEVIDGDPNVPAYKIAMLGASGVGKTTLTYQFTTSDYICAYDLS
LDDDYGQKTVSVLVDNIETDLEIIDHPACEMSTEAFCATYNIDLFVVVYSVIDRNTFAAA
ERVLQYLKENEMLLSRGAILVANKTDLQRHRVVTRQMGRKVAKEIACKFIETSSGLDHNV
DELLVGIVAQVKLNPQRLRLLTELELQRLNLQSTIQKHRGMHLQTRRMVRQMSVCQGDEE
IFDGGLPEGLQNGEANDDPDGVPSTSKASRSRIENPNRKPLNLESILKMGESEVDEDEDV
VKSSQLSKFNMLAASIRHRRPFRKRRSFDGGVTTSAAADAAAELQRRYQLRAMDDLQLEG
RLAGATEERFGERSGLADSDDEEDGEDIVNGGHRNACNRKVVKKLTARTKVFISSVLRFK
KAISLKRRNSSSCSDLFVI
Download sequence
Identical sequences M9PJ04
NP_001259225.1.81976 FBpp0304663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]