SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304707 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304707
Domain Number 1 Region: 410-479
Classification Level Classification E-value
Superfamily TPR-like 0.00000101
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Weak hits

Sequence:  FBpp0304707
Domain Number - Region: 111-147
Classification Level Classification E-value
Superfamily HMG-box 0.068
Family HMG-box 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304707   Gene: FBgn0054041   Transcript: FBtr0332434
Sequence length 549
Comment pep:known chromosome:BDGP5:3R:26333745:26335868:1 gene:FBgn0054041 transcript:FBtr0332434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYYFPTSVMWSALGFSPLLAVLILPKWASSTKMKAYLDLDTRLKTQLRGYSEDLQDHIST
LNRYIDDRKSELDKVGKDPEVYLGNPLNSFSLLHHLHFDWPAWRKLMEKPLATEYITEIQ
EMWSEMPTKDEYTNSIKAAKDFHKNETQGNFEFSPLESLQIALHAYDKKNYTEAENWLNI
TLNGYKNLSLQEKDLYEVLSPVIMVYDETNGAAMIAKSYIRYFSNHQMEFIVMKSACILS
VGLIIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLA
TYHIQFERDKLAIASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTK
NDISEVCHGISKMLNAYLMTAQDIANGVILGTQTKHLMSLRDCVALSDHSMEMKDYNKSK
EWLNVAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALETVEFALKSNPRNAQLI
RMQKRLSYHILLGPPKSPKLNIENNDYRLRKNGSLYCFYDTKIRTFYSLLAPIKAEVLFI
DPLVILYHE
Download sequence
Identical sequences A0A0B4KHI9
FBpp0304707 NP_001263110.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]