SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304708 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304708
Domain Number 1 Region: 427-498
Classification Level Classification E-value
Superfamily TPR-like 0.000000929
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Weak hits

Sequence:  FBpp0304708
Domain Number - Region: 111-147
Classification Level Classification E-value
Superfamily HMG-box 0.0733
Family HMG-box 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304708   Gene: FBgn0054041   Transcript: FBtr0332435
Sequence length 568
Comment pep:known chromosome:BDGP5:3R:26333745:26335868:1 gene:FBgn0054041 transcript:FBtr0332435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYYFPTSVMWSALGFSPLLAVLILPKWASSTKMKAYLDLDTRLKTQLRGYSEDLQDHIST
LNRYIDDRKSELDKVGKDPEVYLGNPLNSFSLLHHLHFDWPAWRKLMEKPLATEYITEIQ
EMWSEMPTKDEYTNSIKAAKDFHKNETQGNFEFSPLESLQIALHAYDKKNYTEAENWLNI
TLNGYKNLSLQEKDLYEVLSPVIMVYDETNGAAMIAKSYIRYFSNHQMEFIVMKSACILS
VGLIIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLA
TYHIQFERDKLAIASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTK
NDISEVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLR
DCVALSDHSMEMKDYNKSKEWLNVAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTL
ALETVEFALKSNPRNAQLIRMQKRLSYHILLGPPKSPKLNIENNDYRLRKNGSLYCFYDT
KIRTFYSLLAPIKAEVLFIDPLVILYHE
Download sequence
Identical sequences Q2PDP5
NP_001034077.5.81976 FBpp0304708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]