SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304749 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304749
Domain Number 1 Region: 969-1082
Classification Level Classification E-value
Superfamily R3H domain 1.84e-21
Family R3H domain 0.0058
Further Details:      
 
Domain Number 2 Region: 368-426
Classification Level Classification E-value
Superfamily RING/U-box 0.000000706
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304749   Gene: FBgn0001978   Transcript: FBtr0332473
Sequence length 1095
Comment pep:known chromosome:BDGP5:2L:15113480:15118069:1 gene:FBgn0001978 transcript:FBtr0332473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYWQQLTNGAGEAGPGNESSAMADCNGGHESAAVGGSCNRHSNNNYVNFNQFIMQHNL
GGGAPSNATSTMQHPVGSSYTNFSLGGGGGAFGLNPPVASASTSHFANAMIPTYQNGDGI
ARVTVTSSYGSVNPSNSNFSSFYTPFGNNPFDFSASKLQASAPEFVPNFAKLSLEETPAA
ATTNGNSTASLETAINETRPRTLRAQEPAERGANNQCSNHNYERERERERDRDRDRERDR
DRDRDRDRDRDRDRDRDSRPGNTRQQRRSDYRDDREDRYERSDRRRPQKQQRYDNHRSNK
RRDDWNRNRDRINGFPRAVDDLDTSNESAHPSPEKQSQLQQISPRRGPPLPPADNEKLSQ
REKLVRDIEQRRLECLVCVEAIKSHQPTWSCRNCYHMLHLKCTITWASSSKSEVGWRCPA
CQNVLQDLPRDYLCFCGKLKNPPVSRTELAHSCGEVCCRIEGCSHACTLLCHPGPCPPCQ
ANVVRSCGCGRSTKTMQCAMKEEVLCGEICDKLLNCGEHRCQAECHSGKCAACSEQVVQQ
CHCGKQERKVPCTRESQDKRTYSCKDSCGQPLPCGHHKCKDSCHAGSCRPCKLSPEQITS
CPCGKMPVPAGQRSSCLDPIPTCEGICSRTLRCGKPAHPHQCGSKCHLGQCPPCPKQTGV
KCRCGHMDQMIKCRQLCNRADDARCKRRCTKKRSCGKHKCNVECCIDIDHDCPLPCNRTL
SCGKHKCDQPCHRGNCPPCYRSSFEELYCECGAEVIYPPVPCGTKKPICKLPCSRIHPCD
HPPQHNCHSGPTCPPCMIFTTKLCHGNHELRKTIPCSQPNFSCGMACGKPLPCGGHKCIK
PCHEGPCQSAGEICRQSCTKPRPTCGHKCAAACHEGACPETPCKELVEVQCECGNRKQNR
SCQELAREHSRIATIQLASSMAEMSRGNYMELSEILAPAKKSNKTLDCNDECRLLERNRR
LAAALSSGNSDTKQKCLTKYSEFVRGFAKKNPALTKSVYETLTDLVKLAKESKQRSRSHS
FPTMNREKRQLVHELCEVFGIESVSYDKEPNRNVVATAHKDRCWFPATSIMEVLARESGQ
RRVPVPSNNAWGLKK
Download sequence
Identical sequences M9PDG3
FBpp0304749 NP_001260460.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]