SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304750 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304750
Domain Number 1 Region: 976-1089
Classification Level Classification E-value
Superfamily R3H domain 1.86e-21
Family R3H domain 0.0058
Further Details:      
 
Domain Number 2 Region: 375-433
Classification Level Classification E-value
Superfamily RING/U-box 0.000000765
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304750   Gene: FBgn0001978   Transcript: FBtr0332474
Sequence length 1102
Comment pep:known chromosome:BDGP5:2L:15113480:15118069:1 gene:FBgn0001978 transcript:FBtr0332474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYWQQLTNGAGEAGPGNESSAMADCNGGHESAAVGGSCNRHSNNNYVNFNQFIMQHNL
GGGAPSNATSTMQHPVGSSYTNFSLGGGGGAFGLNPPVASASTSHFANVSHQSPNAMIPT
YQNGDGIARVTVTSSYGSVNPSNSNFSSFYTPFGNNPFDFSASKLQASAPEFVPNFAKLS
LEETPAAATTNGNSTASLETAINETRPRTLRAQEPAERGANNQCSNHNYERERERERDRD
RDRERDRDRDRDRDRDRDRDRDRDSRPGNTRQQRRSDYRDDREDRYERSDRRRPQKQQRY
DNHRSNKRRDDWNRNRDRINGFPRAVDDLDTSNESAHPSPEKQSQLQQISPRRGPPLPPA
DNEKLSQREKLVRDIEQRRLECLVCVEAIKSHQPTWSCRNCYHMLHLKCTITWASSSKSE
VGWRCPACQNVLQDLPRDYLCFCGKLKNPPVSRTELAHSCGEVCCRIEGCSHACTLLCHP
GPCPPCQANVVRSCGCGRSTKTMQCAMKEEVLCGEICDKLLNCGEHRCQAECHSGKCAAC
SEQVVQQCHCGKQERKVPCTRESQDKRTYSCKDSCGQPLPCGHHKCKDSCHAGSCRPCKL
SPEQITSCPCGKMPVPAGQRSSCLDPIPTCEGICSRTLRCGKPAHPHQCGSKCHLGQCPP
CPKQTGVKCRCGHMDQMIKCRQLCNRADDARCKRRCTKKRSCGKHKCNVECCIDIDHDCP
LPCNRTLSCGKHKCDQPCHRGNCPPCYRSSFEELYCECGAEVIYPPVPCGTKKPICKLPC
SRIHPCDHPPQHNCHSGPTCPPCMIFTTKLCHGNHELRKTIPCSQPNFSCGMACGKPLPC
GGHKCIKPCHEGPCQSAGEICRQSCTKPRPTCGHKCAAACHEGACPETPCKELVEVQCEC
GNRKQNRSCQELAREHSRIATIQLASSMAEMSRGNYMELSEILAPAKKSNKTLDCNDECR
LLERNRRLAAALSSGNSDTKQKCLTKYSEFVRGFAKKNPALTKSVYETLTDLVKLAKESK
QRSRSHSFPTMNREKRQLVHELCEVFGIESVSYDKEPNRNVVATAHKDRCWFPATSIMEV
LARESGQRRVPVPSNNAWGLKK
Download sequence
Identical sequences M9PD57
FBpp0304750 NP_001260461.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]