SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0304920 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0304920
Domain Number 1 Region: 18206-18396
Classification Level Classification E-value
Superfamily Fibronectin type III 7.94e-38
Family Fibronectin type III 0.00076
Further Details:      
 
Domain Number 2 Region: 17996-18189
Classification Level Classification E-value
Superfamily Fibronectin type III 7.15e-35
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 3 Region: 4602-4694
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-23
Family I set domains 0.0036
Further Details:      
 
Domain Number 4 Region: 2086-2182
Classification Level Classification E-value
Superfamily Immunoglobulin 2.96e-22
Family I set domains 0.0059
Further Details:      
 
Domain Number 5 Region: 1689-1784
Classification Level Classification E-value
Superfamily Immunoglobulin 5.05e-22
Family I set domains 0.0087
Further Details:      
 
Domain Number 6 Region: 1819-1916
Classification Level Classification E-value
Superfamily Immunoglobulin 5.65e-22
Family I set domains 0.0019
Further Details:      
 
Domain Number 7 Region: 17710-17804
Classification Level Classification E-value
Superfamily Fibronectin type III 6.53e-22
Family Fibronectin type III 0.00046
Further Details:      
 
Domain Number 8 Region: 1554-1649
Classification Level Classification E-value
Superfamily Immunoglobulin 8.55e-22
Family I set domains 0.014
Further Details:      
 
Domain Number 9 Region: 3397-3494
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-21
Family I set domains 0.0058
Further Details:      
 
Domain Number 10 Region: 1419-1515
Classification Level Classification E-value
Superfamily Immunoglobulin 2.61e-21
Family I set domains 0.0083
Further Details:      
 
Domain Number 11 Region: 4394-4486
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-21
Family I set domains 0.0035
Further Details:      
 
Domain Number 12 Region: 3807-3908
Classification Level Classification E-value
Superfamily Immunoglobulin 2.69e-21
Family I set domains 0.0063
Further Details:      
 
Domain Number 13 Region: 6536-6625
Classification Level Classification E-value
Superfamily Immunoglobulin 4.54e-21
Family I set domains 0.02
Further Details:      
 
Domain Number 14 Region: 16841-16934
Classification Level Classification E-value
Superfamily Immunoglobulin 6.12e-21
Family I set domains 0.0025
Further Details:      
 
Domain Number 15 Region: 469-561
Classification Level Classification E-value
Superfamily Immunoglobulin 6.51e-21
Family I set domains 0.028
Further Details:      
 
Domain Number 16 Region: 1288-1383
Classification Level Classification E-value
Superfamily Immunoglobulin 8.6e-20
Family I set domains 0.0058
Further Details:      
 
Domain Number 17 Region: 2750-2845
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-19
Family I set domains 0.0079
Further Details:      
 
Domain Number 18 Region: 6940-7038
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-19
Family I set domains 0.005
Further Details:      
 
Domain Number 19 Region: 370-464
Classification Level Classification E-value
Superfamily Immunoglobulin 1.86e-19
Family I set domains 0.0038
Further Details:      
 
Domain Number 20 Region: 3535-3631
Classification Level Classification E-value
Superfamily Immunoglobulin 2.17e-19
Family I set domains 0.0075
Further Details:      
 
Domain Number 21 Region: 4495-4587
Classification Level Classification E-value
Superfamily Immunoglobulin 2.32e-19
Family I set domains 0.0052
Further Details:      
 
Domain Number 22 Region: 3128-3221
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-19
Family I set domains 0.017
Further Details:      
 
Domain Number 23 Region: 2617-2714
Classification Level Classification E-value
Superfamily Immunoglobulin 5.73e-19
Family I set domains 0.0087
Further Details:      
 
Domain Number 24 Region: 252-345
Classification Level Classification E-value
Superfamily Immunoglobulin 6.83e-19
Family I set domains 0.0072
Further Details:      
 
Domain Number 25 Region: 1956-2050
Classification Level Classification E-value
Superfamily Immunoglobulin 7.87e-19
Family I set domains 0.015
Further Details:      
 
Domain Number 26 Region: 17068-17156
Classification Level Classification E-value
Superfamily Immunoglobulin 8.41e-19
Family I set domains 0.0089
Further Details:      
 
Domain Number 27 Region: 17161-17255
Classification Level Classification E-value
Superfamily Immunoglobulin 8.72e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 28 Region: 2352-2448
Classification Level Classification E-value
Superfamily Immunoglobulin 8.86e-19
Family I set domains 0.0077
Further Details:      
 
Domain Number 29 Region: 1155-1251
Classification Level Classification E-value
Superfamily Immunoglobulin 9.27e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 30 Region: 3674-3770
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-18
Family I set domains 0.0072
Further Details:      
 
Domain Number 31 Region: 86-187
Classification Level Classification E-value
Superfamily Immunoglobulin 1.21e-18
Family I set domains 0.0039
Further Details:      
 
Domain Number 32 Region: 888-983
Classification Level Classification E-value
Superfamily Immunoglobulin 1.52e-18
Family I set domains 0.0082
Further Details:      
 
Domain Number 33 Region: 2485-2580
Classification Level Classification E-value
Superfamily Immunoglobulin 6.09e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 34 Region: 746-843
Classification Level Classification E-value
Superfamily Immunoglobulin 6.19e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 35 Region: 3259-3354
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 36 Region: 17434-17523
Classification Level Classification E-value
Superfamily Immunoglobulin 2.44e-17
Family I set domains 0.0038
Further Details:      
 
Domain Number 37 Region: 614-713
Classification Level Classification E-value
Superfamily Immunoglobulin 2.67e-17
Family I set domains 0.013
Further Details:      
 
Domain Number 38 Region: 2881-2983
Classification Level Classification E-value
Superfamily Immunoglobulin 4.62e-17
Family I set domains 0.031
Further Details:      
 
Domain Number 39 Region: 2220-2318
Classification Level Classification E-value
Superfamily Immunoglobulin 6.93e-17
Family I set domains 0.0053
Further Details:      
 
Domain Number 40 Region: 7210-7300
Classification Level Classification E-value
Superfamily Immunoglobulin 9.11e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 41 Region: 4090-4181
Classification Level Classification E-value
Superfamily Immunoglobulin 9.28e-17
Family I set domains 0.0048
Further Details:      
 
Domain Number 42 Region: 17625-17718
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 43 Region: 17347-17441
Classification Level Classification E-value
Superfamily Immunoglobulin 1.47e-16
Family I set domains 0.0082
Further Details:      
 
Domain Number 44 Region: 7064-7158
Classification Level Classification E-value
Superfamily Immunoglobulin 1.76e-16
Family I set domains 0.0043
Further Details:      
 
Domain Number 45 Region: 3027-3125
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 46 Region: 17813-17904
Classification Level Classification E-value
Superfamily Immunoglobulin 2.27e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 47 Region: 16963-17061
Classification Level Classification E-value
Superfamily Immunoglobulin 2.93e-16
Family I set domains 0.0077
Further Details:      
 
Domain Number 48 Region: 3950-4047
Classification Level Classification E-value
Superfamily Immunoglobulin 4.07e-16
Family I set domains 0.0096
Further Details:      
 
Domain Number 49 Region: 17914-18003
Classification Level Classification E-value
Superfamily Immunoglobulin 4.3e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 50 Region: 6743-6831
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000165
Family I set domains 0.021
Further Details:      
 
Domain Number 51 Region: 4701-4793
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000221
Family I set domains 0.016
Further Details:      
 
Domain Number 52 Region: 1020-1116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000324
Family I set domains 0.012
Further Details:      
 
Domain Number 53 Region: 17518-17611
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000721
Family I set domains 0.0094
Further Details:      
 
Domain Number 54 Region: 6840-6929
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000418
Family I set domains 0.018
Further Details:      
 
Domain Number 55 Region: 17260-17343
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000421
Family I set domains 0.024
Further Details:      
 
Domain Number 56 Region: 16753-16809
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000122
Family SH3-domain 0.002
Further Details:      
 
Domain Number 57 Region: 6631-6726
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000262
Family I set domains 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0304920   Gene: FBgn0086906   Transcript: FBtr0332674
Sequence length 18468
Comment pep:known chromosome:BDGP5:3L:2039681:2115611:-1 gene:FBgn0086906 transcript:FBtr0332674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRQNPNPYQQQNQQHQQVQQFSSQEYSHSSQEQHQEQRISRTEQHVQRSQVTTQRQVQQ
HHGGSIGGAYVPPSLTHVYAQGDISPPVFEQIFKNARFAQGGNALFEGRLRGNPKPFVTW
TRKGAPLLESQKFRMSYNEATGDVSLLINQIGPGDEGEYTCTARNQYGEAICSVYIQPEG
APMPALQPIQNLEKNIYSNGYSYTSIEEEFRVDTFEYRLLREVSFREAITRRSGYEQDSQ
LSQELDRNQGPAQAPQISQKPRSSKLIEGSDAVFTARVGSNPKPRLTWFHNGQRLVASQK
YEISYSSGVATLRVKNATARDGGHYTLLAENLQGCVVSSAVLAVEPAAETAYEPKPVDVM
AEQLEAGKALPPAFVKAFGDREITEGRMTRFDCRVTGNPYPEVFWLINGRQVRDDASHKI
LVNESGSHSLMITNVTRLDAGAVQCLARNKAGEVAIEAQLNVLEKEQVVAPQFVQRFSTM
TVREGEPITMSANAIGTPQPRITWQKDGVQISSTAERFVGIDGGATCLEIPRVTANDAGW
YQCTAQNIAGSTANRARLYVEVPREQPNYEQRRLNLPRPTKVIEPEPIPGPEIIYLRHVE
RAKPHLRPGEEDRVYPPPQFIIPLQNVQQTEGGRVHMEARIEPVGDPTMVVEWYLNGRPL
AASARATSVFKFGFIALDLLSIMGHDSGEYMCRVTNASGVAESRAILSVVQRPSIEQSSQ
NPNSLQYINQLEDYSRYQRTESIDEQLNQAPQFIRPLRDLGEFEEGKNVHFEAQVTPVND
PSMRVEWYKDGLPITASSRITAIFNFGYVSLNILHLRAEDAGTYTVRAVNRIGEAISQSS
IRVHSRSQVTADLGIPEQQRYIEKVEELEDYRKSQQRRHVQEAAEAIAPPQFKTPIQNQL
DLREHAHAHFEARLEPVGDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTIYDA
GTYTCRAYNAMGQDTTVAQLTVISKNEIVSESQHPGGLQKIQHLEDSSRYGRREEEETYI
TQAPRFLGPLKGTTKILEGQRAHFEARVEPQSDLGLVIEWYHNGRSITAANRIQTYYDFG
YVALDISQVRAEDAGVYLVVARNKLGEAQQQATMIVETRSSIDTSSMHRGLYEKTQNLEN
KPFVEPQYDIEEISKSKPVFVTPLSDPKPIHDGKNIHLECRLEPMGDPTMRVEWFHNGRP
VTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNHLGTAHTSACVRVIDHTDVVTET
QNEQSLEQIQLLEDSRRRHHQEEDITIMQAPQFTRGLHNIETIEGTNVHLECRLQPVGDP
SMRIEWFVNGKPVKTGHRFRPAYEFDYVALDLLGCYAIDSGVYTCQARNQLGEAVTSCSV
RIIAKNDLILETQNESGLQKIQYLEDSTRHRRSEFVDEVVNIRPRFLTHPKSLTNTREGG
HAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVHLIAEDSGVYTCR
AVNLIGSDETQVELQCRSGEQIVTVTQNEAGLEQIHYLEDRSRYTRREEIDESTKQAPVF
TTSLKNVEIKENQRAHFECRLIPVSDPSMRVEWYHNNLPLKSGSRFTETNNFGFVALDIM
STLPEDAGTYTCRAYNAVGEAITSAVAVVHTKKSIYLESQHETALPRLQHLEDGSKRQRI
SVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEASNRTT
TMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSASLIVQSKTSIQLETQHEAAMHK
IHQLEDHSRYQRREEEEYTVTTAPVFVTKLIGPSNLVEGQSAHYECRIEPYPDPNLKVEW
FHNGKPLSTGHRFRTTYDFGFAALDILTVYAEDSGEYTCRVTNNLGEAINSIVLNVTSRS
SIIHETQHEEALTKIQHLEDTSRFQRKTDEEQFHAERPQFGRPLRNAKVNEGAPVHLEAT
LIPVNDPTMKVEWYCNGRPIQTGHRFKTTYDFGFVALDILYAHAEDTGTYMCKAKNAIGE
AVTTCAVNVTANKTLDLDTLDAQRLEKIRQLETYAPPPKPVVEEKGQKPIFLTPLSNLEH
LKEGEHAHLECRVEPINDPNLKIEWFCNGKQLPTGHRYRTTHDFGYVALDILYVYGEDTG
TYICKATNQLGEAVNTCNVRVLNRRSMILDTQHPDALEKIQKLESKVPNARTEVGDAPIS
PPHFTAELRGSTEIYEGQTAHFEAQVAPVHDPNLRIEFYHNGKPLPSASRFHITFDFGYV
SLDITHAVAEDAGEYSVRAVNALGQAVSSTNLRVIPRGTIISDTQHPEGLEKIRKLESTA
PHQRQEPETPGTRQRPVFTQPLQNIDRINEHQTAHFEARLIPVGDPNLKVEWYRNEKIIE
DSSRITKQHDFGFVSLDISHIRKEDEGVYMCRAVNPLGEAVTTASMRVVSEASIQMDTQH
PDSISRIHQLEKPLAPRPTEPERLFEKPIFTQLLTGPSELWEGTHAHFEARVVPVGDPSL
KFEWFINGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGVYMCRAYNAAGEAVSSTAMKV
KTKSNIDGQPLIPESWEAIRLKEAAMNRVPEMFVDSTPQQAPVFTTHLQSYDKLHEGQHV
LLEAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLVTLSINGLRADDSAIYTCKAT
NQVGEAVSTSSLKIEDRHWLQAESLHPDSLPRIGELEAPKEGRPEAPEPTYETPVFITHL
NNIECKESDNVRFECNVEPARDPTMSIEWFYNGQPLQAAAKFKSIYDFGYCALDLTNSYA
ENSGVYTCKATNSKGSATTSGTLKCTGGKTMFLDTQHPQGEAGLEAVQETEEELANRYTS
KTTKPETQYPPPVWTKPLQAEFHLSEAQPIHLEANVEPKEDPNLFIEWYFNGKMLNHGSR
FKMTSEFGFVTMDMIEVYARDQGIYTCKAYNKAGEAFTSTTIFCSSKENIIESTQHPKGA
EGLEQIQDLEDSLRKDGSKPEQPDLGIPPRFTTEFVNIADIGEGELAHFEANLIPVGDQS
MVIEWFYNGKVLEASHRVRTIYAFGTVALEVLGTKIEDTGTYTCRATNKHGTAEISCNLE
CVDKPRGQKPRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIK
TVSDFGYVVLDISYLQDHDSGEYVCRAWNKYGEDFTRTTLNCGGRGGVFYDSLQPDSLQR
IRELECPQGQQADTSAPLVAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWY
FNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGEDVTRASLKCASKSS
LILDSQLPRGMEGGLEKIANLEYSMVRTREETTEETKGKAPVFTVPLENIENLREGENAH
FEARITPADDPKLKVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAIN
EYGEAVTTATMKIQGKRSIIMESQLPKGMEGTIDRIAELEGLGSRSTEFVPDDDTGKPPE
FITSPFDMVIGENALAHFECRLQPINDPSMRVDWFHNGKALWAGSRIKTINDFGFVILEI
AGCYQRDSGLYTCKATNKHGEATVSCKLQVKGRQGIVMEPQLPSNFRTGTESLQKLEETM
HKREELVTEDEQPNPPKFTEEIKDNLDVPEGGPIHFDCRVEPVGDPTMRIEWFYNGHVMA
TGSRVHQLNDFGFIALDVDYIYARDSGEYTCRATNKWGTATTSAKVTCKGKHNIVYESQL
PEGMTSEKLKELERGRIPEAPKVVEEVFGPPKFTTQITSVTVDEAEAVRFECQVEPKTDP
SLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDSGEYVCRAINNYGEDRTRATV
SCKKLPTILLQNQVPRGMKRSDALTQMEATIKKYTSEVHLTEDDLFDPDRKQPPRFVTQI
KEQLTLTEMAVTKFECQLAPVGDPNMKVEWFFNGKPLLHKNRFQPIYDFGYVAMNFGWVY
PEDSGEYVCRATNLYGKDETRAIIKVSGKPGIVYDSQLPAHMQSIDRIREMEASWQVVPD
EVDPDAKPRTKPVFVSKLEPQTVEEGDPARFCVRVTGHPRPRVMWLINGHTVVHGSRYKL
TNDGMFHLDVPKTRQYDTGKVEVIARNSVGESIATTELKVVARSDDYRNVLKNSPRPWYD
YELAAYQKERQENELEKVFDERKQVLSEQSSHTLKGVEHLKPKQYKPPTPDWQQNVKAKK
SEDYYNKLQTLETEQLLKETNLRRDTHQYAIPGEKVVSSSQAKGMAQSYEENLQEKTSTT
EVQAAPPKGIAQPSESSVHGREVHMNKQQQVQKEIQGDLEITRKITATETTEVEHKGTIQ
ERVVQGPVKPAKAPVFTKKIQPCRVFENEQAKFEVEFEGEPNPTVKWYRESFPIQNSPDL
QIHTFSGKSILIIRQVFVEDSAVFSCVAENRGGTAKCSANLVVEERRRAGKGGIQPPSFV
TTIQSTTVATGQLARFDAKVTGTRPLDVYWLKNGMKIQPSIKFKMLEEDSVHTLLIIEPF
AEDSGRYECVAVNAAGEARCDGDCIVQSPSKPEKPTTPGSEKAPHIVEQLKSQTVEEGSK
VIFRCRVDGKPTPTARWMRGENFVKPSRYFQMSRQGEYYQLVISEAFPEDEGTYKCVAEN
KLGSIQTSAQLKVRPIENLDAPPTITALKDVSVTEGMPAQFKTTVTGKVKATSVQWFREG
QLIPETPDFQMIFDGNSAVLLIGTTYEEDSGIFTVRVTSSTGQVESSAKLTVKKRRISAF
QLRTIDSAEDESSSSGREDSAPESPHAFQPGQQPGQQFGQFLGVNGQGQHQGRSRQKKPK
VRSKSLQPATKVIPWRKSSRPTRGRSLDKGVFLPGFKPEPVKSWTEETINLKATPIEKKK
PAPKLEAAKVVLKSIKTERDQGIMSLGATLEQIIAGKTEKEAIPWITMREKLKAVESVQQ
QLNKFDLDEVYLQPLEGQIETEGQLPQQAQVEQVQRTKEIQRLKSMESVEIMEMTDQIDK
LITQQQNAKDLIPWKEMRQQLKSVQRVTKQIDKFKIEEVELRHLQAQQAITEEYQTGTAE
ETVVMIDESSKGSISKVLRRDEQLQYEDQSNIYKQKFITTEDVNIMHVSEREKLEAQRLI
REQQAVNWRQQQQRPQLQPLTSVEDTVISQTSERQKLVQQQSFIEEAQRQQFVQVEDSQM
MSLEEYEHQKIINQRTQQEAFSWRQPREPQKFIQVEDSTLLHLQERHDTQEQQLLQQQPV
MWDRGRKKPDQPQYVQPQEQRVKEEFVEKPKTYEEMHDELVEPTPIEQPQPVPVMWERGK
KKPQPQEKTFEEAHDELVEPTPVQQPEPVPVMWERGKKKVAQQETVLSQEVVQTSQVVEQ
QIVEETKKTAVRRVIPPREPEQKVEQVTLKPTPRPRPKEAVKAEEIQLKPLRSTRPVPQP
VEAEQKAYEEATDELTEEPIPQPQPVMWERGKKKPQKPQEEVTEIPKTLEIAVDTLEEEV
PKPTEPQPQPVLWARGQKKPQKPDEQKQELPKSLEIAVDTIEEDLIKPVQPEPQPVLWER
KKKKPQPQDVIEEKLDVAPTKTYEKAVDVLPDEPKVEEKPEPVLWQRGKKKIPKSEPTEE
VHPDEVDAQIETVVKEDEMIVEEKRRIKKTKRPKSTKEVTEELFEEQPEEEISPEEEVPQ
KEVIEEIEEIVEEKRRLKKTKKPKLTQQVTEEETPHEEIIKESEEVVQEQEEIVEEKKKV
KKVKKPKTVAEKQLKEEEIPTEETVEEEETAEDQQLVVEESKKVKKVKKPTGTVEKTDVE
ELPGEEVPVEEVPVEEVPEDVAPEEELIEEQEEIVDQDEIQEQKRKVKKAKKPKKTIEKT
EIEIEEDQPEEEVLQEEIIGEQEEITERQRKVKSIKKPKKVVTEKTVDQTEQPEKPEESQ
AEEVKETVTEEPKKPKPAPEEAKVEQVEKISLKPAPRKQRLLPEKEQVEEVLLKPVKKIV
AVSEAEQPETPETEFEVKEFAITTTEDILDVTKKRVKKKKPKTKVAAEESTEEPAEETEE
FEEEATQPEEVQPVEEIPEEPQVKEVADERKTAPKPKPRKEEIIEKVEEVALKRVTRPKK
ELPQEATIEEVRLKPTQRTSIKPEEVKLEEVDLQHVEKKEDEIVQEEKRKTRKVKKPKHE
DLPEIPDAEPTQLEEAEHIELEKQPKPEEDQPQVPWKRGEKKQPVEEVLEEKKWPSGKRR
PLPEQQPEEVQLKPIPSKPIEEQQKPEKAIPGPQLVPEEKPESEEEELELEPLKLPEDKK
PKEPKAKKEKKKKPKLKKATPSVDEVSEEVAEPFDEPIAEEDEVEEMPVDDVKVVAVSED
VLPEEEVVPTEETPEAKQKAHKKRTKRLKEASVEGQPQLLEAAIAEIEKVDEISQEISQK
TITLLKKTEDTRPQFITTEQLIELDVEDVRRDLEMKVTSNIIKKEKRRVVLDDSQPLPEL
ELITQKRIQEGIDKVADEELIEDQQLIQNQQETTTSEVIGQERKLVKKKKKEIKPPRITE
KLRPRQCVPEEPTVLECKVEGVPFPEIKWYFNDILLFASEKYEITVMEQVAKLKIAKVTP
SDVGVYTCEAKNEAGVATSRTNIILEKEQGVPPQFTKPLKIEFIEEKQPERLKVTVTCQV
TGKPNPEVKWYRGIEEVIPSETVQMFYDEKTGDVALEVINPTPNEAVVYSVQAQNQFGRA
IGNANILSRVDEVPREILKAPTVTPLSAVVVPTGGTLFFEAKYDGLPRPEVKWMRNGREI
IENEETIIETTETTTTIKVVNMTRKRTGKYEVWAKNKVGEAKSSGSVVVSDQKPDEQIKP
PRFIQPLEPKYFGEHEVAIIEAIVESEPLSSFQWFVHNEPIKSSNEVRIVSQANKSTLLI
ENFQSKFVGPFTCRAENVGGSVTSTATVNLIPQEEAEEFESPRFVEELVQPVEVMDGEAL
LLTCQVTGKPTPKVEWYHNAEKITENKETTISQDLQGVCQLQITEVFPENEGQYECVATN
KIGKSVSKTNVKIQAFEYIPDSEITGLTGSEEDLLDRTLSIDEQAPKIIKKLPEKIEPKE
GEQAKLEVKVVGKPKPKVKWLRDDEQIFASEEYQIENFEDGTSVLVINHVYPDDLGTISF
EAYNPLGVAVTTALFAVEVKFFFRCLELHYLCFPNSLESSIVGSKDYRKPEWVSQMEEMQ
VALKAAKCSPSLLNEMRDCRAALGETAKFSIQFAGNPIPDIQWYFNNVQLRASEKYRMVV
QEQEATLEIMKITSEDCGYYNCKLINEIGMTMTRAKFDISSTSTIVEETKAKTTVKKKSG
KKTMVKRSGASESQNVQKTEIRIIPTSAVETSMNVIKVKQPVSVLVEKSEISEVLVVKDR
EVADAEERSSQLIEEIEEEEEIEEKVQHDEEDEVEVQVEQKETYTSSKKIEITKTVELIR
TKISEKIITIEDVQVLSHHEEVQWLLESIEAESFGQIGESALRDLATIGLLLRYGCEHYE
ITYMYEQNIFISLKKPESQSALVQLVEREGHEELISQILSESSNEDETILAATVGFKAFI
RMIQTYEITIEIVIRKFVREDFISQDWKICGKERIVETSQIIESHEAITHVKIEETFVEE
RTIIVQEETATTKVEKLFKKQEQEHVQNLEQQEQVKIQVQTKQIAQMNTKIKKHKKHKQQ
EQEVSETTIQCEQKETLAHETSAELPQSETLEQIEESLSTYETLPIQNLSKDTLQTVAVS
VTTELSTPSPTASRVQEEILPQKVLAINEEVLPLDEFGLRKESPRPKENKLTENIEVRLK
HALNVSHAKTAESSKELPSKIPKSVKAQRKMKESRSLVVEAPNAEEAIEDLKPLKAVSQE
VQSDILFSHEITEEQHQALETIEKLKPTSAIEDTVQQKLLSQEELIIAEVLPSETVGRDV
TDVRPPGETISPRLTPNMSLCITECQPEDSIGEMQQAAKERMETPSMSVTESKAVGGQEL
EVLENVDHMPLITQPTKGLADYTIKAEEVPVQVQEIITFDSLERETVAKTQTAKSNALEL
FELSEGLVSSTADSHSPIAEDLPIFEKDVKEATIDMQMQHHVTTSETVSNENAVKDLKAV
DTPKMAEGTLGQSSALTIGETQQMNLVETTVELIEPNVESTKPAKGALTEAYGTAESNEE
TLLESLGLVPDDNRKIEQGKVNISEGEYVAKVQTTTVTDTEGEFVSVAPKLVNPKFDFVE
QSALQIKQDTTVEKEEILSSNIELAPQLATSNMFPAELKVTSIYEVQPGLTSSDIITEQT
KSVSANQVFETMSIGVTSKPDMLESTSHIDAFQHPEFKTGDTILDENQQPLEVTNVQITE
SSTDIIDVLPNQKLTKAETVTDGFKYAEGLVVLPMESTIDKTEDTKPTAVNADISMHQQF
GTDVREQEPLESTLTRTEDLKPQTQTTESQFGLLQSLETSSCVTLEGESVLSVKERHPEQ
SAAIGTSSALQVANITRPQHMESLDRLDEQKVPYYQANVNIGEITLPNVEKIDSFDVLSD
LNTPDYNKSSKGRVQLIESTTSLKTTTAVVSESTEELKDLNITQPVHIKPKPYESDQKIS
ISEQTNVLEHVSSLNPVLPALETIQSSIKSLHEINVRETDILEKEESLKDVDHISGRLAK
IILDCTTGIAQVRQEETLEHEEDLKAPLIPLEKAIPASSELHRLPLTEYVQEQQGTSDMT
DFKVSNKCASPNIDHLYETKSSEMIVYDSSINSVDSEFPAGIVPQKSLVPFRHTMVTENV
AFNASENFEILSADQQIATNVQDSLSQSIIAEDQIAFETEQNLGLETTPTHKPKLLKDDQ
NLHAKLVDEATVYEAMGQEQKVDKYNIQQAEITHDLPQVYATDLQQTFEAEKEITTREQS
YVAATTDIIPSRLGLAMTTKTHPVEGIDVLLSSPPKPSLAQTNYEETQHEVRVRETQAIE
ESEELTDGRLLPVSAVESIDSTFKVTSDSQQPPVFDKELSIPTVSPLEARAKPSLNLLQG
TTTFDVIPLESSVLLKDTHVAVQKAQQEYVAQVESNKVHVQMDNLVMHKEDIFENAEIEN
FCKPITEGTQLETVVIEVVPIDNVGGIHLAPQPSTLLATLTSTDIVNQSHVIDTQVPLEM
ESEAQAPLDNIAQARIKSAEDHVHTNVSEVNVYEQTKAIQDQNKHGLFVKVSKNSDTSKA
YLTTIQSTFLKEDILPKPNILQDTAQAAADELQSLVTEEVVSVSSIQETYELKIPLQKTA
NLTQQTPQNSVNVCQQLAYEETPDIAFEPHALTRATTSSVPTFLKPAENATVNIYENIEG
HGDFKPGTVNLTSNSNLNSELVVSVVQEVTSVPSLGSLATVEPQELKAMPVTKSSTNLAY
SEEGGIPYVQITVEEAKLVNTRADVEENITSVTTEQPNMCIAASIQLPAIEEKKLENALQ
TPQFASESILKTSPQISRNAHFETRTHEEEYSTTTESLVTTQALRDDIDSTQKNVMQDVQ
MYKHFATKSLDKTVKVETDTNQATDTTHIKQKTPTHKLASSTTQITESPEIIKTIETISE
DGSPSKKMIRTRLIKKVKGNKQEFTKIETVEEDDKQPETTVTVEELPYEEEKPEEIQELP
EEVCVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEVPYE
EEKPEEIQELPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPE
TTVTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGKPKKKKIRTRFIKKVKGDKQEVTKI
ETVEEDDKQPETTVTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGKPKKKKIRTRVIKK
VKGDKQEVTKIETVEEDDKQPETTVTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGKPK
KKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEVPYEEEKPEEIQELPEEVRV
VETVTEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEVPYEEEKPE
EIQELPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTKIETAEEDDKQPETTVTV
EEVPYEEEKPEEIQELPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEE
DDKQPETTVTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDK
QEVTKIETVEEDDKQPETTVTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGKPKKKKIR
TRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEVPYEEEKPEEIQELPEEVRVVETVT
EDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEENDKQPETTVTVEEVPYEEEKPEEIQEL
PEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPKTTVTVEEVPY
EEEKPEEIQELPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDNQEVTKIETVEEDDKQP
ETTVTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTK
IETVEEDDKQPETTVTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGKPKKKKIRTRVIK
KVKGDMQEVTKIETVEEDDKQPETTVTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGKP
KKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEVPYEEEKPEEIQELPEEVR
VVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEVPYEEEKP
EEIQELPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVT
VEEVPYEEEKPEEIQELPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVE
EDDKQPETTVTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGD
KQEVTKIETVEEDDKQPETTVTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGKPKKKKI
RTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEVPYEEEKPEEIQELPEEVRVVETV
TEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEVPYEEEKPEEIQE
LPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEVP
YEVEKPDEIQELPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQ
PETTVTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVT
KIETVEEDDKQPETTVTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGKPKKKKIRTRVI
KKVKGDKQEVTKIETVEEDDKQPETTVTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGK
PKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEVPYEEEKPEEIQELPEEV
RVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEVPYEEEK
LEEIQELPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTTIETVEEDDKKAETTV
TVEETELSAPSVGKVQLKKRVIVQKPEDAVTVFELPERKSVILSEKEDGTPTKTVIKTRI
IKKIQGPNMEVTKVQTVEEYEKAPQTIVSVEKFNTPFPELPEERLSEVVMLPDEVFESEA
VDEEGRLKMIKTKKRIIRKPALDNTEEVTEIGIIEQDNVEPIYSVKIQERPLTESKPEDS
KLIELPEHVTELNVILPDGKKKRRTVKSRAFKKSLDDDLDEVTTIHIIEEEDKEPLTKVN
IEVVPSDEISITPIPIEELPEETVFTEELDENKKPKKKTTKTRTFKKRGPDDDEYFQIQT
IDEEGKEPISLIRVVSDENIADIIDISKLDDEKVLKHKQKPHKHKVDKPKADNTETEHPV
YITTFKSVQNEDGETTIQTENKRISQEEGIVVEEVLSDTELIPEDKTQLHLEITEVSEPT
DQYYKEYTITEPEEASADALQKPTKDKTPKQKKTLETPIEEVDETVIIDEGTGEQTDQIA
IKRKPRKVQGNVQVEAVDEKPIEKKEKAKKKKVVKTKRDEMDDYIQFLIHQEIPKTVLQP
YQRTEMELPQRARRDSSFKQPVKLTPMKIEKVEFKKPKMVEISSVVEFPQMLKLKAPKQR
PQEEKKKKNEASFKNKKLKSWIRFVPYAPYCFPYVVTELETNREVGELSRNVDEAEEVLK
LRPKKFKHSKPEKAELEEADLGAYESDHSDKSNKELLHPKYKRGKKEKIETPDESRKLKF
GKGKVPQNEEASEEVNLKPVKLDIAEIEDAEMPVRTQEEEVVKKKKPKKSSKPEEGLQFE
PIEFEEMERTSDIREESDTSVSVDTSTQEKPIYKKKKKVTPSPQKNQYKILPGQPREFEE
TPEDDLNLRKRQGERPDDDKADTKLKPFYKFEVLDLEPEGVQAETVPLSETIAKEPKKKR
KIKVKTEQEDNTIEIVPLSPEDNDEQIFEITVTSSEIPQGDAKAKTIGKKKVKRMNKQEL
DDFVTELQEEPNQEVYETRMSDFYEVKLTELPSEMDSDKPTKRILRHEKGDEVQVLEIVE
SVVAPGEEPFYEINVISSANTEGDSEEITTDKIKKKSRKIKKDDLDAYIQQLINAEIPVT
ELEKYEKIDVDGKAKKPKKLKAKTKKPIIDEGETLQVGVTEHEPTKKLKTKKPEEKKNVI
EKELAEHEAVPEYDEFLINKTESERPQEKRVEETEKDIVPIVDKVLADLNDCLPFVVVEE
DLKDMPLATDVIALEDEKIIRKRKVRAKKDSKQYEIEIIETEKPGDIPDEARVIVITTEV
SGDTIDGPAPSTTEAPKKSVRKVKKEKLKEFIVNIVEEAPLDHVSEIYEDVLRTPFRESS
EKEDIPSFTTTVVEDEIVNPVLPEKIKTVDDVRVPKDKKKKIDNQKKIKISEFEPTPTSE
DSTIEEYTPKLSEHDEDLQTDEYSVDVKDSLPKSKKKSTKKQKKESLPGPISLYTIRIEE
TTPEPITEKIYEDGKEVVRVINKRRIKKKAGPKEYLIEVIETYEDNNPEADVVIRTIETT
PSIDSKPQEDHKIQVVQEKKPKTESLDNYIQKLIDQEIPQVDHKEFKATVLETSPESKKA
KKIKKHHKKTTEVIDGIPITVIEVTIQETETDDEDFKPDEVTLKEIDHENAEEAPKVLKS
KVSEEKPKSKKEKSLEFKIAEEDKPKPVLEDISEDVQVVQIIEEDGTPKQVEIKKKKVSR
KHGPKEQVFEITETKAIDEPLSEVTVVEITDEQPQEEVLPAQEKKPIKKQKKLKPEDVNT
YVVKVLEELTEPTQFETIPEDADDKPQPVIEDISENVQVVQIIEEDGTPKQVEIKKKKVS
PKHGPKEQVFEITETRPSDEPLAEVTIVELTEEGLNKDIVIPQEKKTVKKPKKLKPEDIQ
SYVIRVLEEFNEPQWPASTEKPIIEDIAESIEIVPVTEEDGITKEVEVKKKKVSRKQGTK
NQVFEIIETKTSDEPLAEVTILELSGDKSQEVTILPKEKKPIKKTIKLKPEDVESYVVNV
LEEFCEPQSFESPEPTEGEAHETKTKTKKPKKPIVKAPENVILIEEMAPETVIENIVNEI
GEEVKQVKTTKKLKKKEGPKEYLIEIKETYEENKPEGDIEITTTELVPEGSPDASDDQPV
IVVQKIKKKKPVKDDLDKYIQQLIEQEITKTPLEEYEPTEMDSKKKPKKKVKSHNKKTIE
VIDGLPVTIHEFNVEDIVSEPEDMETPKTLLDEIKEIPQLPDDSSKYLVNISDEFGEADK
PIKQPTQDQPIKKEKPLKKKKDVEYPVSLEAFDHTVKVVSEPTLEGTVKEVTVKKRKVSR
RKGSKDHIFEITETTSEDRPTAEVTVVELSSDEVLDSEEKPKHERKIVKKPKQLKKDDVE
EYIINIIEEFIQPIPVGLVEDEVEKVQKEETKKPKKSPITYIATEQEDNDNNYDALVKED
LDQPIERALEKPSSPLEYTISVEEDSVGEEQKQPKPKKISKPKSIKQPSVDKSPDYLVNV
ISEESIIDEPIPEDYVVTEAAEEKPSEEPTFKVEELETEAVEKEVTDDDKGETTKQSVTK
RKIKKLVGPKEEIIEIVETKTGDTPEYEVIVTTEEVQEKSKEAPEEKKAKTVRKAKKIPK
DDLQDYIQKLIEQDIPKTELEKYEKIDLDEPVKMKRKPIKKVKQSEEQPKEETEEPIEDK
PVEKISEYSEVDSDEPKLTVAVKEFIPEKPEEKPFEIVVLEETVESKREPDEEGKVREKV
VKTKKIKQNRGSVEVVHDIVEEIDTDTNESVITVTTTVPTETPDQDQPSVKQKRTKKIKK
DEVEDFVKRVIEEEAPQPEGSVDLVVIEDFVPKPSSEKRKKKPIKDKHTSVEEETPHEDE
VLLIESVPEDSPLSDDLITVVDSVPIEEEPENKVNQIEDTKKPEKKKKPKPSAKILEENV
PEDTVEKPLEALHTDSDLEKPDVQEFSISIKEEEQKHTHPEKKKSSKISSEQPKQPSTEQ
YEISVTEHDLKPEEEKPFTVQVIQSETNVEETKDDTGKVHKQVTTKRMLRRPAGEGEIEI
IEVVRDDQPEAEITIVEYEPEPVNQDEKPKEPKKKTRKVKKDDIHDYIQKLIELETPKTE
LEKYEKIEFEPIVKDKPLDSPIDVLDESPKEVQKKDKKSRSTKVPNEETPVQEQYAKVNV
VEEEAPEQPEIPVQILEVKPVEVDVKEVITEDGKPVQEKTTKRVLKKIGPEEQTTFKITM
IESEDNDSVTVIVDEEPEIASPQSIEEHPEQSKEKLAPKPKKTVRKVKKDDLSDYVKKLI
EEEIPKVDLEKYEKVEMPEKPVKLTVSDSIPEEPKPDKSQPISVLPDTTKPKKTKTPKTP
KTEDTDQQVPDEPTETTVDTTDIPELTPTQTAQPEDTATAQITPSAQEEKSTQDDTKDTI
QKTVKHKKTKPDTQKSVETSELPEVHKDYQISIIHEELVEEEQPEKILEVRVIDEVAEVE
ESQPIVEEVEDEEPQPATEETVEDVTKPKSKKKKVVKKKTDDHDELIKKMLEQEIEKTEL
EKYEKIEFDVPKKLKPEFAALEPIKIERKEQKPTKVTILDATDVPKTVKLKPSKRKEKPA
EELTVQLPKFRLKARMVLVEYPPAPLIPKTTDIGAIKDNGELSRNIEEAEEILKFKPHKT
KKIKKIKDDLEKVELEKYEKYISSEEEPEEKTPYKKPEKAPKPEEKQEDVKLKLGKGKKK
PKEEEAPENVTLKNIPQKPQEVEEEVELKQKPKEVEIVEEQTKKPKDGEFVVEPFEPSEF
DRPEYVPDELEQIEHPEIPEKVKKPSKTKYKPKDKSKSEPETIVSEIVAGVPKEEEAIPE
QDVKFRKPERDAPEETDSEIKLRPVPQASKDENPDEQALVTPKAEEPIPQEIEDKAIDDE
KKPKKSKPKKVQPKEQEIAKEEPEEFEVSVKEEEALVDKPIEIEKPKDVKVKEKKPKEAP
VSEVVVIEEEPKPEEVPEEIPVEYKITTTVLEPEDAPKEHQVKVIDFDERQETTEEVIEE
KVVTRKKKPKPQQPEEFEVTLKEPKEEQIQPDVVSAEISLPIEEPEQKPEQYEVELKITQ
TTPEEPNDVQIAVKEKVKTKPVKKVKEDKIVVVEAEEEKQPVEETIVEVEKQEEKKKSEK
PKSYEFKISETQSIEEKPIEVAEEAPEETPKVVEKKVAEKFDSYEFTLKETDEEKVITVD
DQPEEEAPVEVVFKKKPKEPEAVEAEFVMTEPKIVEETSVETAIKQKKTKKPKKDEEEAQ
LAIKVVESEAPVAEEVFSEAPESKIVEEEVIAEEKPKEFTIRVSESEPKPEEPSVEQFTV
KKRKPSVTFADEPATEIVIKESKPAEVVTEDAHIKTKKPKKKVTDVEAEELKIKITEEVP
QEIPILEEVSEEEVITETKKTAPVVEEKTYKIGIKETEPEKPAEAIVEEEEPVVTEPIEE
APKPEVFEEHKVRVIEETPRELVEEVIEEEVKVIRRKKPKPEIKEEPEAEVTVSTPKPVE
EVEATSSIAVIPEQPTEEEAADLKITIIEEETPPQELVQEIEEIEIVEEPKAPEEQPTDF
TFATKDSEKKPTVEELPEEQVTIQKKKKKAPVPEVVEEPEAEFLVKPKTPVQEVTEEAKI
TKSKKPVKEEEAAAELKVTITEEIPTEPEVQEIIEEIEEIEEEKPAEYVIEVKESQPEAV
EDKEVSLPKKKPKAPIVEEPEAEITLKPKVKSEEVQEEAKIVKKKPKKIDEVAVADELTV
KVEEEVVPEPIVEEEVIEEFEIKKKPKEPEPEDIVDAAIVKLKKPEPVDADEVVAEVTLK
PKAKTEVTEEEFSVDVKLPKEKKVTEETSDQTVQLKKKKKPQKPVEEAADELKLQQTVVE
ERPVEIEEEEIIEEAVVIRKKPKKPFEPTVEDLEETEFSLSFKKPHTINEGVEEAATVLK
KRPVKPTTLDEAAAELSIKRQEEEYEEGEDIEEFVVSQQRKPKPLQITEEDEEAYTVKKL
KRRKQVDIPEYADVENVTFRARSTKTKEDVDQEFNIALDSYAEEEISMSGKVKLKKPIKK
TFSEAADEAKIKIIQDFDDGEEPIIEEIRDDEDTIDEVEEPEEYFVEELPPDEVDFKLKP
KKHPKPAYSVQDEEEEQFLIGIRHPKRDSVTYDEDSLTFKKKRKVVQQLFNEDGASLNIT
REMNVEESENLNIMYSICNYIADNNEAINLVEGEKVTVVGRHSSEWWYVKKSTTEEEGWV
PAQYLMEPEEYAQYVQNKLHEKIDKLPVFERPGPEDKPIAPRFIEKLQPIHTPDGYTVQF
ECKVEGNPRPQIAWFRETAIIKPSQDFQMFYDDDNVATLIIREVFPEDAGQFTVVAKNAA
GFTSSTTELIVESPLSDHGSDATALSRRSMSRESSLADILEGIPPTFSKKPKAQYVDENT
NVILECRLVAVPEPDIVWTFNGEDIDEEEIKNVRIVTESDMHMYCSVVHISKVKKSQEGT
YEVIATNREGEARLPITLKVRTTDKEAPQILEPLRNMVIREGESVVLSTQIVGNPPPKVT
WYKDGKPVKNAKSDKDLHTLTLITPQKSEKGEYTVKAVNPLGSVETTANLTIEEPAGGNA
EPPLFVERFEEQNVPQKGEIRLPAKVSGNPVPEVQWLFNNTPLFPSERIQQVYDGENIEL
IIKDANPETDSGDYKCIASNPIGKTSHGARVIVEVDEVTFTKKLKKTITIEEVQSLTLEC
ETSHVVTTKWFFNGKELSGMDHRVVVEDGKTHKLVIRNTNLRDSGTYTCKVKKQETQSTV
EVLQRKPDFIKVLEDYEVTEKDTAILDVELTTEATEVTWYKDGEKITPENKNVEFIKDGK
ARRLVIRDVTIHDEGQYTCKIEGQECSCELVVIELPPEIVEPLNDVAVTKGENAVFEVEL
SKGDALVKWFKNGKEIVFNERIQLAIDGKKQSLRIVKAKPEDVGEYSVQVGEQTSKAKLT
VEEPLVDFVIRLPDITLATKTTDAEFTVQLSQPDVEVTWCKKGKPIKPNQKHEVFVEGTV
RRLVIHDASDEDAGEISCVAENVTSSTKLCVEELKLPPVITSDKDQTIKVKENDDVTFTV
KYTGVPTPEACWTTRKVVIPKSKRTIPTIDEQSAKLTIKKVVDDDEGEYTVKLVNPVGEA
EASLHLVIMRKPTAPGTPQPLEIMHDSITLYWKAPEDDGKSEIIEYILEYQDVKEEKWTE
IRKIKDTTYTISKLKIDTEYVFRSIAVNEVGPSPPSPLSPPIRLVPKVETKAPSVQEPLQ
DVVSELDKEVTLSCVFGGIPEPKVTWKKNGQVFESRSIRYENRVAKYTIEKTTIETEATY
TCVATNEKGSAETSCRLKLQQKPVLEVEDKYLTQKLRTGSILTIPATVRGYPQPTVTWHK
ETIEQKTTKSVTIETTETTSTYTVKKVTREQSGKYKVTATNESGTTYVECTVQVIDKPSR
PQSLEIKDIKKDSIVLEWTPPVDDGGLDIEKYTLEKCDVQNNVWMKVSDFNKDIKSYAVQ
KLSMNAQYMFRVVAANPIGESEPTESDPVTITKKFEKPSPPRGPTTVSGMNDTSFNLAWE
PSETDGGSKIIEYIVEIREETETTYRSVGVTLGTVTNIHVEKVVRNKGYFFRIYARNEVG
TSEAFETTEKIVLGRKITNDNEALAPPSPPQNLRAPDVTSRSVTLDWEVPARNGGSEITG
YCVEKRSSTSTNWTKVITLDAHQLHYTIDNLKEKCEYWFRVSAENEVGLGAPAVTESISL
KTHATVPSPPTGPLEARVLAANAHIFEWGLPESDGGAPLLGYHIAIRDMKKTMWIEVGRV
PAGVLKFQIRDLQENHEYMIRIFAKNEIGLSEPLESEEPYKAMTAGHESLPDEPRTEMSS
CNTSSWLRDHHMDADIHSYARGRLLQRDEYFFRLWAELPKSKKKKSSK
Download sequence
Identical sequences M9PEA0
NP_001261304.1.81976 FBpp0304920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]