SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305076 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305076
Domain Number 1 Region: 30-79
Classification Level Classification E-value
Superfamily RING/U-box 8.33e-18
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305076   Gene: FBgn0034312   Transcript: FBtr0332853
Sequence length 263
Comment pep:known chromosome:BDGP5:2R:14061174:14062749:1 gene:FBgn0034312 transcript:FBtr0332853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESNSSEMEGNGGKIAETAPTNDSSPSLNILCAICNEFFRANDIIFSTSRCGHVFHKDCL
TRWLNRSRTCPQCRDPCDRRRVHRLYLNFAEAPEFDDTELPKVAMDWVPIDLDRDSLPDA
HLPPEGAVQCGTNEDGLPTYVARGYYHDDLLPAPYVPEKKAAFGSHSCSARTLTDDVEIL
VLNDCDYKWVPGQHGTYPRDALNTGYSELGEVTYTGRGLYQGILRLGKVHPSHKVMYIPH
HGQEVSVNTYEVLVVTPRDQADR
Download sequence
Identical sequences Q7K1R6
7227.FBpp0085928 FBpp0085928 FBpp0305076 FBpp0085928 FR513 FBpp0085928 NP_001261070.1.81976 NP_611303.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]