SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305160 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305160
Domain Number 1 Region: 1-249
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.28e-72
Family IMD domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305160   Gene: FBgn0053558   Transcript: FBtr0332942
Sequence length 1802
Comment pep:known chromosome:BDGP5:2R:2812192:2859142:-1 gene:FBgn0053558 transcript:FBtr0332942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSLERDSSALGSLFQQIINDMKNTSPLWEDFVAKAGKLHTCLRAAIQAIAAYLDAFQK
IADAATNSRGASKEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVA
TIDKDHAKEYKRCRSELKKRSSDTLRLQKKARKGQTDGLQSLMDSHMQDVTLRRAELEEV
EKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAMQSIALVTKEPSVLPQA
SEELIHDAKASINLYPESPGGGSGSQGGGCSNSLGSRKSSVCSISSMNSSGSSNSPGHHH
YPRSLSQFVTPAIRLKPGESSDSGFCSSPALTTQTSNATNQTANVSTWPPHSQDGVDTLP
PTADRPHTISTAYEKGHQRPPLTVYTFQNPETIHESGSCLNNGTAAPNGQPLSGQATPAT
QKSPAASLSRPPLPVRCSSLERPLSAQSNHRQGSGNNLLQRQCPSPIPAHITKGTPSGSS
LGPGSGLGFVYQVSSPTPPSSEVLKITEQAAAGQDQGPANSVADETDERSRASVLQKASM
FEKAAAAAAVSPPAPMQIASGSPASGGGTRRSEAEQQEMDKSFEDSIQALNNLIGELDSF
QREIDEGKVKPPSNIISGSTTSSNNNNTTTSSISSSDNNNLPATSNIEPCAISNQTNSSG
CGTDISDTTSDELAGDDMDVRRRDRDRDRDLLGASDSELSRCYVSETSSLTGGLTAGGYE
NPTFAHFAANANREDAVSLASDSVCLGQPRHAYVDTCSDSGSAVVVIYDHQIPNTPDIEF
VKQNSEIVVLRTKDPQPHALQLHEMRELQQLPANLAGSPDSSPDSAGGQAPPTATVAPAK
QRLSSFRATSEQQLQLLGRGSPQRGKTPSEQAVQSRPQDQHFPQTQQQDIDGSSPPVELA
RRQLPPKPTSLSIFNGPVPTAGDRPVVPRKSDFKADLDAKIRRQKQKVKQQLQQQQQQQQ
QEQQETQQQQQAPQEQQHSPQSPQTRNCNVTNQQAANITASASAFATATASTDPYPNPNH
RMPNQNQTATSNHTQCKTPTMALSPSSPRGHLPLSSSSLSSLPLPATTSSPSNARPSMLP
ASDRPPAHPYVCSNAPANPHHANSISNANAHLKPCITPRPASLSGGAAGGGSTRIGRRSS
INQSKPPPPVRRSSSVTPSPNASVGLQQQPQHATLSQQNHQLSSSSEHLPPPPPFMLDAM
PQIPSSALKVSETVRALAAMRHQPASPVSLRRMQQQQQQQLQQQQQQQSAHNSPLKEDLT
VYYDSYLDLHAYAQALASGQQPGGQQMANQQRFTLQQQHQHLHQPQQPPVYQVDATFRTS
SPAAGGGGGGGIYAQPKLVNSMSSFRTSSPSPNGHAHPLPPTQPKANPNLIAQLNARLSG
KQQQHQQQQHIEGIYGNQQAPGGESIYMRSGLSMSQPQQQQHFDATSGSASSHYQPPQPP
NAAVANSKDMAIYSSSFTKNPAAAQSPNMRQAHSHQHHQPPQQQHYTCPPPLEDPPPPPI
YAAGASATMPKKMARPPTGQNATHSSAYAAASSTATLPKNMMQQQQRLQHQQQYQQPAGM
GIGNGNGHLGQRPQLPLPQQKLRAAQQQHLAEQQHQQQQEQQQHHQQHQQHQQRQPPIPS
RHSSVQQKIFVSTNPFIQTTAVKFHSPSASPTCGSPVTGSLASIYATTSRGGHHHQQQQA
QQQQHYYRDAAGGNSNGGAAYYNHNAHAHSQAHHPNYATSTNIEKTGSIRAKTKAEFLEN
LNAKLAKQGMSGRAFAVRNLINSKALMYQNPQKLSRPSAQYRRPPTYPNTSTTTNATCED
QC
Download sequence
Identical sequences A0A0B4KEE8
FBpp0305160 NP_001260748.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]