SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305188 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305188
Domain Number 1 Region: 237-295
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000053
Family RING finger domain, C3HC4 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305188   Gene: FBgn0031282   Transcript: FBtr0332972
Sequence length 297
Comment pep:known chromosome:BDGP5:2L:815993:818096:1 gene:FBgn0031282 transcript:FBtr0332972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAANVRQNLQNVPSIFEISASETLDNLIYPALSKIFDYFGLRLDFKLWGSLRIQEELS
PLLTWLLQYLYLRKRASSFGESFYGLQRTVTTTGDLLNRRQQFASATLLTFMPYVERKLR
TRITRHEDTSPWEQRLLSAFHAFHAAKAAHTFFYLVKYASNHSPIFRLLGLTLRYPSEPP
KEDQWTYVVLKMLEVLAFFLQFVQWWYSNDQRRKVGGTLINPEAMPRKQLPKEVQQSLPQ
RGECPVCLLSIQTPTACSVSGYVFCWKCIVSHMKEHGTCPVTHYPISLDDLVRIYET
Download sequence
Identical sequences M9PBP1 Q9VPT5
FBpp0077675 FBpp0305188 7227.FBpp0077675 FBpp0077675 FBpp0077675 NP_001259844.1.81976 NP_608546.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]