SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305283 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305283
Domain Number 1 Region: 2942-3056
Classification Level Classification E-value
Superfamily Bromodomain 7.46e-35
Family Bromodomain 0.00016
Further Details:      
 
Domain Number 2 Region: 2555-2616
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000244
Family PHD domain 0.0027
Further Details:      
 
Domain Number 3 Region: 2618-2675
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000062
Family PHD domain 0.0052
Further Details:      
 
Domain Number 4 Region: 892-967
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000157
Family Methyl-CpG-binding domain, MBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305283   Gene: FBgn0033636   Transcript: FBtr0333070
Sequence length 3058
Comment pep:known chromosome:BDGP5:2R:7464990:7480631:-1 gene:FBgn0033636 transcript:FBtr0333070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKNAGDGSDGKNSNKNSNAGGGGGAGGPHDPTGLLDAASLFAYWGRDPTGAAAAAASNP
LFNSQFNAAAAAGLGLLPQAGGASANDRYSMAAAAAAAAGAHHHQNTMAVAASQAASLAG
LHPASWWSMAQLAAQDYFSRLQASGLSPFPHPDLAAAFGPAGMGMGGGAGGAGAGGGGAG
VLGQGGGGNGGSGNGGGGSSSGSSGSKSNKSRKEKRAAQQQQQQQQNLANSLNAAAAAAA
AAAANNPAAALASMHGFGVGVPGTSIPSVSTGSGSISTNSGGHGSYKSTASAYGKPSTMT
SSSMANNPGSAYDPVTLHKELLAMQAVAAAASGSGSSGSSGKKSGGGGSSSSSMHSLGMG
IGGSGGMMSSGKASTSVSASNSSLGGMHPSLTSSNPLMSPHAGMGSSSSSSSKDRDKNNP
SLNALNSLSQFGALGMTPQQSMQAAMNAFAASTGVSPSATVTSSPHHSSQQQQQMGGNSS
TSGSGKSSSKDYMMGTGSEHPSLLGVRLPPDTEIIKYTSSIVGPKIPGLSPAKRARLEME
YAAMAAAAQQQHQQAQQQHQAQQQLHGMLGAAGIPGMAGLVGLPGMSGNPLDQLSVSKAS
SSTAPTTSTSSSSAGSNLLNQSNSDRVEVIKLPPTITSNGAYNLSSKGKEVHDLTTDMAT
NSGGVNLSLKSNAGSSALTPSGAVGSASNPITIDDFDAPLNLSMKPSDKSNSSSSNAAAG
GSSSSSAALANLASDYQAASSGQSGNSLQSLSSITAALGGTGGMPGGSISGSGGTSPAPA
GAGSGATGGGSGSGGSGGGSSSYKEGRPRNLGRGVSKPKKNTVASLLAQSRAVGLKPMLA
TQQLLQQGADIEKIRLALSEANAHMETSTDSESVAAESGLSESESEDANILNVAELRVPL
ELGWKRETVIRGLTKQGQIRGEVTYYAPGSTTPLKSNGQVFAILEQQPSNLSRENFSFSA
RAIVGSFLQPAPPPYANDGEYIRMTDEDVAKRLEDLKVFTRQTLNVEQRIEIAKQQQAMR
DAKKLQKEELARNKEKARQEKNSKLEQQRKDKELKNQQAVEERKKRQEELDRLKQEELLK
KQQELQKQKEMLLAAEMERERRRQHMSLIRMLELRRKFEDREKKKHQLVLDRLLLRERRM
AERKRDAEILQLIRRPNEDSEMPQELVIPELDRIAGNRLPGQAMADLLMVFEFLHNFGET
LGFDMESLPSLQNLHDALMSDSNADAEEELLSVMTHLLVCAIEDPGVPNPGRHTTLLGQS
LRNADITNSNVSEILRIYLYATATGEVRQMHGITVDRERERRVPDHHQLDSDTTTHSHSV
KNQEYYKLLHENDTWKLSQSLKDRPFVALNPTRKAQMLAHLCNDLLMNKAVLRQIDGSLE
TCAQMRKEKYMTDMKVRKYKALHMRKARIEAYERAQAEREAAMQALMAQQKLDAERLKAE
EEAKAAAAEEAAAAAGTDGEATKGGSPNGEKPEDGDQNEEGAAKEPQQQQQQPMEVDGVV
DEASLVSPAKTIIQTDNSLTPSKQDMPTPTYQINGSSTPTTSGVTGGDMNVLLQAKKSGA
RNSINDEHHHDVSIIDDDLSDLDSEITNVEEDEDNRLSADELQKKLDKIVRASLNCKEAL
EKSTNQLRAACFGQDRFWRRYWKLPKAGGIFIEALESAQNDICDYHEALEAMDDKKDAND
EKENSENEKDVAAESSEQPMEVDESITKLEDGVPASDVGMPESNQQNAHQDEEDDDDDVT
EINKVEPEIVDLGDDDDDAAPPLPKIEPPRPEIKVKSEMELMGPPPTTMISTKTDFEAEI
KIPSMPGILMPPTLNNNNTNNNNNNNGSDNCDKLETGLGLGQQQQNFSQSVIKTEDVKKE
DDCIIVSTSSVDDTPKWFSIVRREVPLISELPAEEGGVVGQELQISYANQNCSAQLQLQG
HPWDLINNMQYYSIPMDECKVDTSKLGNECIFSLSGLDEKQMLAKVEEYKAHKVESKNGL
GSPHRHHETKDDEEQAKLKLDKEIDTEMETDADDLAGKEKFFRLRSDVPPDTGGGVSEGT
DVKPKIELRLDEALSQAYYHNIANMSLSSVQTYIPIDIPLPLSMTPDEHRLLEQVKLAGF
PERVHGVYVPRRQRYGWWQLDDEQKLRQLLKTLNPSGLRERELQENLQRFLGLEQPLGVN
YKLKSDIDFPEEFLMPDKKGDWNPKVAKRVELALIEQLESLEDKVASASMQLKNWQLPNR
VESELTLDSQEDVTEEDFVSIIPMIRERIIDLEANIERRYLKPPLGSQTGDAHLAVIAQN
QHTTTQTQNSASAAAYLLQMQQQQQQQQLAQQQQQQQQGSGAGNSLNPSSFNERTMALAA
AAAASGPGNATGVANSAVVAGATPCESGSGEPNSGNASPASNCDSDRDEKVEQIPKGLVQ
WRDAVSRSHTTAQLAMALYVLESCVAWDKSIMKAYATKNKSSKKKSSAKKQATPSKKQQQ
KKNKKEQQLTPNGKESKSKSAINKPENQAPLSIKINLKALAQNGQCLLKTKTPPILTKSP
TASPSSHPNTSDSDSDFGKRTKKKSGGKRRRSANNTNSSKYSNSLQNCQFCTSGENEDKL
LLCDGCDKGYHTYCFKPKMDNIPDGDWYCYECVNKATNERKCIVCGGHRPSPVGKMIYCD
LCPRAYHADCYIPPLLKVPRGKWYCHGCISRAPPPKKRSAGGTSGSSSKSRRDRDRESGG
SAKRRSDNSKTPAMEHMQQQQMPLAGGDSHHHHHQQPPSLNSSHDESMNSLPAAPLSPAH
SVVSATNYDDQHHANNSVDGSSRFHAHLIPPSNNGTAALLEDVPGGANVMPGVYPVYTPV
AAGNFSAGLINQAPVQPAMPFANVVAMSPRAVTPTRTRTPTPTPAPTPPPPPPTPLLMQA
SPTATALHVNACQSPPQQQHAQLMTMPSPPAIGVGTATNQMSPPPINIHAIQEAKEKLKQ
EKKEKHATKKLMKELAVCKTLLGEMELHEDSWPFLLPVNTKQFPTYRKIIKTPMDLSTIK
KKLQDLSYKTREDFCVDVRQIFDNCEMFNEDDSPVGKAGHGMRKFFESRWGELTDKHS
Download sequence
Identical sequences A0A0B4KFE3
FBpp0305283 NP_001260898.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]