SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0305286 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0305286
Domain Number 1 Region: 277-451
Classification Level Classification E-value
Superfamily NTF2-like 3.51e-40
Family NTF2-like 0.0011
Further Details:      
 
Domain Number 2 Region: 116-260
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000578
Family mRNA export factor tap 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0305286   Gene: FBgn0263232   Transcript: FBtr0333073
Sequence length 559
Comment pep:known chromosome:BDGP5:3L:13958303:13965106:1 gene:FBgn0263232 transcript:FBtr0333073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVLDTISSTEEDHRVATVTGWSTVNIANCAGVSNSSIFVALKWVMMPIKVEIFNFKRS
GPEDNMARGQFLLDNLLSANRLKRLQEEVAVINTCQKIEVRVTPGLPKSMMCAQITDEFT
TAIQEALRSRYEVDSRTLDLSRFHASPELSLHFCPLHMVKLLETVLVLSNHLFPHVTSLV
LSNNYLCSLKAFAGNSQSFASLERLDISANRIQDLGELNYINKLSCKTIFLAGNGLAKLS
VDVIRKMLPQLKNVHGCVQLGESTEAVDNIPKSQQLQGGGTNGLKFCQDFISSYYTFFDD
TEERFKLKKYYDDQAMFSLSVPVQLNYVYGYKLYNRNQKRQHSSFAQNAKLQVGRAALLL
ALSRLPLMHTDLENVGLDIQVFTSSLRIFTLTGYFKEISSDTLEPRRFQRTFVLQTSNSP
GWLITNDMLCITSTMPDPKKTIKFKPETNMINTDPSVEKINKPAVTVLDRKSKEDVQISR
PLSGKELNPLNKAVQKMSLSQVDHLPSENFNDMPPLVAIGPLTTGQNCLDYEMEDILVAD
ENNFDLDIDDDILFGCDDL
Download sequence
Identical sequences Q8IQK4
7227.FBpp0075502 NP_001287064.1.81976 NP_729938.1.81976 FBpp0305286 FBpp0075502 FBpp0075502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]